BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001154-TA|BGIBMGA001154-PA|IPR010561|DIRP (570 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-2|CAD27474.1| 92|Anopheles gambiae hypothetical prote... 25 4.1 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 9.5 >AJ438610-2|CAD27474.1| 92|Anopheles gambiae hypothetical protein protein. Length = 92 Score = 25.4 bits (53), Expect = 4.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Query: 59 KPAPSEPVQKLNARGMPARIRKKNRFIFVDDF 90 +P+P VQKL P IRK R + F Sbjct: 58 EPSPERKVQKLEPTEAPCYIRKDGRAVHPKPF 89 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 9.5 Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 2/18 (11%) Query: 89 DFVNTSPPR--QSPKKTP 104 DF+N PPR QSP ++P Sbjct: 434 DFINKEPPRPGQSPTQSP 451 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,983 Number of Sequences: 2123 Number of extensions: 22872 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 57 Number of HSP's gapped (non-prelim): 2 length of query: 570 length of database: 516,269 effective HSP length: 68 effective length of query: 502 effective length of database: 371,905 effective search space: 186696310 effective search space used: 186696310 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -