BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001153-TA|BGIBMGA001153-PA|undefined (203 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive ... 24 3.7 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 8.5 >AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive chymotrypsin-likeserine protease-related protein ISPR1 protein. Length = 187 Score = 23.8 bits (49), Expect = 3.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Query: 54 ARGSGYPYTKPIIPFSDEEVDRGSSINAN 82 +RGS P PI PF+ + GS N Sbjct: 22 SRGSASPIDHPISPFAANYIVDGSDAEEN 50 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 8.5 Identities = 15/49 (30%), Positives = 21/49 (42%) Query: 42 PPVGNSRGQILPARGSGYPYTKPIIPFSDEEVDRGSSINANRWQSNGYR 90 P V ++ ILP+ P+ +IP V G+S N S G R Sbjct: 495 PSVQSAETVILPSGVLETPFDVQLIPSVGAPVSNGTSDATNLTPSAGVR 543 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.133 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,116 Number of Sequences: 2123 Number of extensions: 8550 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 3 length of query: 203 length of database: 516,269 effective HSP length: 61 effective length of query: 142 effective length of database: 386,766 effective search space: 54920772 effective search space used: 54920772 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -