BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001151-TA|BGIBMGA001151-PA|IPR013057|Amino acid transporter, transmembrane (253 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium... 25 2.8 DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 25 2.8 DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium c... 25 2.8 DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodi... 25 2.8 DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodi... 25 2.8 AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. 25 2.8 AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel pro... 25 2.8 AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel pro... 25 2.8 AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel pro... 25 2.8 AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel pro... 25 2.8 AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel pro... 25 2.8 >Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium channel protein. Length = 136 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 64 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 100 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 24.6 bits (51), Expect = 2.8 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 15 IGTIVIAFVCGHCVHIFVKTSRGCCKLVRRPLLSYSETCK 54 I VIA +C V T + CKL ++S S TCK Sbjct: 18 IAAAVIALICAIAVSGTTVTLQSTCKLFTADVVS-SITCK 56 >DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium channel variant 1 protein. Length = 78 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 18 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 54 >DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 12 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 48 >DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 12 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 48 >AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. Length = 80 Score = 24.6 bits (51), Expect = 2.8 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 15 IGTIVIAFVCGHCVHIFVKTSRGCCKLVRRPLLSYSETCK 54 I VIA +C V T + CKL ++S S TCK Sbjct: 5 IAAAVIALICAIAVSGTTVTLQSTCKLFTADVVS-SITCK 43 >AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 >AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 150 TFVICMYYIFGDEI-NFTDKRISGDLSRLPAFLSTVI 185 +F+I + G+ I + D + GD+S +P FL+TV+ Sbjct: 21 SFMIVFRVLCGEWIESMWDCMLVGDVSCIPFFLATVV 57 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.333 0.146 0.469 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 250,441 Number of Sequences: 2123 Number of extensions: 9251 Number of successful extensions: 47 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 26 Number of HSP's that attempted gapping in prelim test: 47 Number of HSP's gapped (non-prelim): 26 length of query: 253 length of database: 516,269 effective HSP length: 63 effective length of query: 190 effective length of database: 382,520 effective search space: 72678800 effective search space used: 72678800 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.5 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -