SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001150-TA|BGIBMGA001150-PA|IPR013057|Amino acid
transporter, transmembrane
         (252 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY062432-1|AAL47188.1|  391|Anopheles gambiae putative odorant r...    23   8.6  

>AY062432-1|AAL47188.1|  391|Anopheles gambiae putative odorant
           receptor Or5 protein.
          Length = 391

 Score = 23.0 bits (47), Expect = 8.6
 Identities = 11/46 (23%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 201 IVETVFRWNDLGKFKW--ILWKNVLILLFGLGSLVSGCTVTIMDII 244
           ++E +FRW  LG+F    ++W ++++ +   G       V ++ I+
Sbjct: 258 LLEIIFRWVFLGQFIQCVMIWCSLVLYVAVTGLSTKAANVGVLFIL 303


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.330    0.146    0.447 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 241,572
Number of Sequences: 2123
Number of extensions: 9597
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 252
length of database: 516,269
effective HSP length: 62
effective length of query: 190
effective length of database: 384,643
effective search space: 73082170
effective search space used: 73082170
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 47 (23.0 bits)

- SilkBase 1999-2023 -