BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001146-TA|BGIBMGA001146-PA|IPR011701|Major facilitator superfamily MFS_1 (384 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 25 3.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 8.1 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 25.0 bits (52), Expect = 3.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 243 TKIEVASCVMVGAVSDLLARFGLAIFTY 270 T + V +CV+V V+ L+A L +TY Sbjct: 841 THMIVLTCVIVSVVACLVAALSLVYYTY 868 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 8.1 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 52 GVIRGAGFGVMIPVSFTAFNSYFTKKRTTMMSANQTMSSLASITF 96 G+I GA G+ IP + TA +YF ++ ++ M + ITF Sbjct: 2766 GMIGGALTGLSIPFNLTASIAYFVGMGLSLSASIGVMIG-SGITF 2809 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.328 0.141 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 343,622 Number of Sequences: 2123 Number of extensions: 13027 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 3 length of query: 384 length of database: 516,269 effective HSP length: 65 effective length of query: 319 effective length of database: 378,274 effective search space: 120669406 effective search space used: 120669406 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -