GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001141-TA|BGIBMGA001141-PA|IPR001660|Sterile alpha motif
SAM, IPR011510|Sterile alpha motif homology 2,
IPR002195|Dihydroorotase, IPR010993|Sterile alpha motif homology
         (391 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    27   0.89 

>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 27.1 bits (57), Expect = 0.89
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 8   PYDHNMPSEFEKEEAIPRGSPSPSLREVRSRLGS 41
           P D  +  E    +    G+PSP+L+ V+S++GS
Sbjct: 635 PSDQPLIKEVPMNKIQVGGAPSPNLKVVKSKIGS 668


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.134    0.413 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 337,986
Number of Sequences: 2123
Number of extensions: 11191
Number of successful extensions: 18
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 1
length of query: 391
length of database: 516,269
effective HSP length: 65
effective length of query: 326
effective length of database: 378,274
effective search space: 123317324
effective search space used: 123317324
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 49 (23.8 bits)