BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001138-TA|BGIBMGA001138- PA|IPR005135|Endonuclease/exonuclease/phosphatase (404 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 6.4 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 6.4 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 6.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 137 DDMYLAHRVLQAYSTAEFVKLTSSPADVSILAGDLNT 173 D M H +A+S++E K A + L+G LNT Sbjct: 1105 DTMLANHLHREAFSSSELQKAKDRLAKLQELSGGLNT 1141 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 6.4 Identities = 7/23 (30%), Positives = 14/23 (60%) Query: 221 PKQVKAYPEGKRIDHILFHTNHS 243 P+ +++ P GK++ FHT + Sbjct: 1137 PRYIQSQPAGKQLSMFFFHTKET 1159 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.137 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,855 Number of Sequences: 2123 Number of extensions: 18338 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 2 length of query: 404 length of database: 516,269 effective HSP length: 66 effective length of query: 338 effective length of database: 376,151 effective search space: 127139038 effective search space used: 127139038 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -