BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001137-TA|BGIBMGA001137-PA|IPR000398|Thymidylate synthase (253 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 6.9 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 6.9 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Query: 104 VIDSIKNNPADRRMLICAWNSSDLKKMALPPCHCLAQFYVA 144 ++D I N R I WN L+ P CL + Y+A Sbjct: 284 IVDHISNQFVAFRRKIYKWNHGLLQ--GDPLSGCLCELYMA 322 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.4 bits (43), Expect = 6.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Query: 187 EFIHTTGDTHVYLNHIEP 204 E + ++G+T ++L H +P Sbjct: 240 ELLRSSGETRLFLTHRKP 257 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.138 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,526 Number of Sequences: 317 Number of extensions: 2857 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 253 length of database: 114,650 effective HSP length: 55 effective length of query: 198 effective length of database: 97,215 effective search space: 19248570 effective search space used: 19248570 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -