BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001137-TA|BGIBMGA001137-PA|IPR000398|Thymidylate synthase (253 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 25 2.8 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 6.4 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 24.6 bits (51), Expect = 2.8 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Query: 44 KGVHIWDANGSRNFLDNLGFTDREEGDLGPVYGFQWR 80 KGV W S+ ++N F+ +G LGP +G WR Sbjct: 324 KGVDWWKV--SQYAMNN--FSLEVQGGLGPTFGKAWR 356 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 92 DYTGQGIDQLQSVIDSIKNNPADR 115 D TG+ +D+++ V N PADR Sbjct: 642 DCTGEQLDRIELVGGGRLNGPADR 665 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.138 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 283,404 Number of Sequences: 2123 Number of extensions: 11869 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 2 length of query: 253 length of database: 516,269 effective HSP length: 63 effective length of query: 190 effective length of database: 382,520 effective search space: 72678800 effective search space used: 72678800 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -