BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001134-TA|BGIBMGA001134-PA|undefined (177 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 29 0.016 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 1.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 3.3 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 29.5 bits (63), Expect = 0.016 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 119 AFKLSLD-SPQTSSSTGDNHAAFKLSLDSPQASSSTGPCKLISARTTLTKNDTTSS 173 +F LSL SP SS +H + DSP +S CKL S+ N +++S Sbjct: 38 SFPLSLGMSPYASSQHHHHHLQARPPQDSPYDASVAAACKLYSSEGQQNSNYSSNS 93 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/32 (28%), Positives = 15/32 (46%) Query: 84 QSSHSKPASQPQQDHRSRLTRFLALRHAPTLP 115 Q S+ P +QP + + + + A H P P Sbjct: 77 QHSYQSPQTQPARFYSTPIVPHFAYNHNPLTP 108 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 3.3 Identities = 12/44 (27%), Positives = 17/44 (38%) Query: 112 PTLPHRAAFKLSLDSPQTSSSTGDNHAAFKLSLDSPQASSSTGP 155 P L R ++ S G +K+ DSP +SS P Sbjct: 81 PALKSRKLNNNNVVSSTNQEIRGPKRKTWKVEEDSPSPTSSVSP 124 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.128 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,871 Number of Sequences: 317 Number of extensions: 1849 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 177 length of database: 114,650 effective HSP length: 53 effective length of query: 124 effective length of database: 97,849 effective search space: 12133276 effective search space used: 12133276 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -