BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001133-TA|BGIBMGA001133-PA|undefined (65 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 21 1.1 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 21 1.1 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 18 7.4 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 18 7.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 18 9.8 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 18 9.8 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 18 9.8 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 18 9.8 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 21.0 bits (42), Expect = 1.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Query: 10 QGYKYIHNADLSPICGIFEDIRTSCQHLR 38 Q +K H AD+S +RT C+ + Sbjct: 71 QDFKKKHKADISGNPRALRRLRTQCERAK 99 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 21.0 bits (42), Expect = 1.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Query: 10 QGYKYIHNADLSPICGIFEDIRTSCQHLR 38 Q +K H AD+S +RT C+ + Sbjct: 71 QDFKKKHKADISGNPRALRRLRTQCERAK 99 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 18.2 bits (35), Expect = 7.4 Identities = 9/30 (30%), Positives = 12/30 (40%) Query: 1 MTAKSWRKVQGYKYIHNADLSPICGIFEDI 30 MT R + GY + P FED+ Sbjct: 275 MTGPQQRVLSGYHALSGLKAPPGVEHFEDV 304 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 18.2 bits (35), Expect = 7.4 Identities = 5/14 (35%), Positives = 10/14 (71%) Query: 2 TAKSWRKVQGYKYI 15 T ++W K+ GY+ + Sbjct: 625 TIETWNKLFGYQIL 638 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 17.8 bits (34), Expect = 9.8 Identities = 6/16 (37%), Positives = 8/16 (50%) Query: 11 GYKYIHNADLSPICGI 26 GY HN +CG+ Sbjct: 491 GYHGFHNPFTCNMCGV 506 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 17.8 bits (34), Expect = 9.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 27 FEDIRTSCQHLREYNDTTYRA 47 FED R S +L TT++A Sbjct: 140 FEDERISVMNLITEEITTHQA 160 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 17.8 bits (34), Expect = 9.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 27 FEDIRTSCQHLREYNDTTYRA 47 FED R S +L TT++A Sbjct: 140 FEDERISVMNLITEEITTHQA 160 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 17.8 bits (34), Expect = 9.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 27 FEDIRTSCQHLREYNDTTYRA 47 FED R S +L TT++A Sbjct: 140 FEDERISVMNLITEEITTHQA 160 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.138 0.447 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,389 Number of Sequences: 317 Number of extensions: 521 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 65 length of database: 114,650 effective HSP length: 43 effective length of query: 22 effective length of database: 101,019 effective search space: 2222418 effective search space used: 2222418 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.9 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -