Silkworm BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001133-TA|BGIBMGA001133-PA|undefined
         (65 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT025057-1|ABE73228.1|  481|Drosophila melanogaster IP15830p pro...    26   7.5  

>BT025057-1|ABE73228.1|  481|Drosophila melanogaster IP15830p
           protein.
          Length = 481

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 11/44 (25%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 16  HNADLSPICGIFEDIRTSCQHLREYNDTTYRAV-GVRDCYITRY 58
           HN  L+P+    +DI  +C  L  ++ +  R V  + +C++  +
Sbjct: 297 HNCLLNPVLRQLQDIELTCPELTVFSPSLGRCVRDLAECHVESF 340


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.326    0.138    0.447 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,172,201
Number of Sequences: 52641
Number of extensions: 98211
Number of successful extensions: 397
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 397
Number of HSP's gapped (non-prelim): 1
length of query: 65
length of database: 24,830,863
effective HSP length: 45
effective length of query: 20
effective length of database: 22,462,018
effective search space: 449240360
effective search space used: 449240360
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 53 (25.4 bits)