BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001131-TA|BGIBMGA001131-PA|IPR001247|Exoribonuclease (375 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 27 0.29 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 24 1.5 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 23 2.7 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 26.6 bits (56), Expect = 0.29 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Query: 28 NFNETRKLDISFGSEYGCCIVSLGETKILSEVTCEVAQP 66 N + RK ++ GSEY IVSLGE K ++ CE +P Sbjct: 847 NLYDARKPYVN-GSEYHPSIVSLGEYKCVT-CKCENGKP 883 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 301 EHMLALSRKDLNIQLKHY 318 EH LA R+DL I L H+ Sbjct: 191 EHRLAYFREDLGINLHHW 208 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 23.4 bits (48), Expect = 2.7 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 181 DPIPTVLYHYPVCTTFALYSNDILLTDPNFLE 212 +P P Y Y + AL +D +L+DP+ ++ Sbjct: 144 NPTPPPHYTYQIIPYEALNVDDHILSDPSLMD 175 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,292 Number of Sequences: 317 Number of extensions: 3800 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 375 length of database: 114,650 effective HSP length: 58 effective length of query: 317 effective length of database: 96,264 effective search space: 30515688 effective search space used: 30515688 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -