BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001130-TA|BGIBMGA001130-PA|IPR002524|Cation efflux protein (353 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 26 0.43 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 25 0.75 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 26.2 bits (55), Expect = 0.43 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Query: 150 NADRALGHNS-TDNEETDEM---VKKAKTQNHKSCKSSSDPG 187 N+DR+ G S ++++E D + ++ T +H S +SSSD G Sbjct: 192 NSDRSAGSPSVSESDEVDVIGYTSNQSDTDDHSSVQSSSDSG 233 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 25.4 bits (53), Expect = 0.75 Identities = 14/43 (32%), Positives = 21/43 (48%) Query: 150 NADRALGHNSTDNEETDEMVKKAKTQNHKSCKSSSDPGHMNMK 192 N D HN DNE+ DE + ++ S S D G +++K Sbjct: 409 NKDILHEHNVDDNEDHDENMIIPPKKSDMSNMQSDDGGPLSLK 451 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,648 Number of Sequences: 429 Number of extensions: 2755 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 353 length of database: 140,377 effective HSP length: 58 effective length of query: 295 effective length of database: 115,495 effective search space: 34071025 effective search space used: 34071025 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -