BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001128-TA|BGIBMGA001128-PA|undefined (69 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 1.4 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 22 2.5 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 21 4.3 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 21 4.3 AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical prote... 20 10.0 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.6 bits (46), Expect = 1.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 38 TNGSGGADAKHLDVGDASDDEKVIENKLFMG 68 T+ SG + + D +D+ V E+K+F G Sbjct: 1486 TSHSGNLLKATVYINDINDNSPVFESKIFTG 1516 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 21.8 bits (44), Expect = 2.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 29 WSTPAGAPDTNGSGGADAKH 48 W+T G+ TN G A +H Sbjct: 124 WATEWGSKSTNARGNAVLEH 143 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 21.0 bits (42), Expect = 4.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 47 KHLDVGDASDDEKVIENKLFMG 68 ++L +G S+DE+ + LF G Sbjct: 16 QYLGMGSCSEDEERLVRDLFRG 37 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 21.0 bits (42), Expect = 4.3 Identities = 8/16 (50%), Positives = 9/16 (56%) Query: 33 AGAPDTNGSGGADAKH 48 AG P T G G A+H Sbjct: 204 AGIPGTKGEKGEPARH 219 >AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical protein protein. Length = 195 Score = 19.8 bits (39), Expect = 10.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 28 PWSTPAGAPDT 38 PWS PA +P T Sbjct: 31 PWSFPALSPTT 41 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.311 0.130 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,158 Number of Sequences: 2123 Number of extensions: 1962 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 69 length of database: 516,269 effective HSP length: 47 effective length of query: 22 effective length of database: 416,488 effective search space: 9162736 effective search space used: 9162736 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.5 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -