BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001126-TA|BGIBMGA001126-PA|IPR002005|Rab GTPase activator, IPR000632|Yeast Mrs6p protein (523 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 5.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 9.1 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.0 bits (47), Expect = 5.2 Identities = 9/22 (40%), Positives = 11/22 (50%) Query: 240 CLEGVKECKKFLMSLGRYGNTP 261 C K C + L RYG+TP Sbjct: 292 CSYATKYCHSLKIHLRRYGHTP 313 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 9.1 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query: 178 VEKRMLMKML--TSIVGYSEEEMNNEFKDWNNKTLKEYLTHKGLTPNLIHYI 227 +E M+ L T Y E NN FK ++N T Y + L+ + + I Sbjct: 80 IESNMISFYLEATDDFAYFLEVSNNNFKTYSNVTTCSYYSLDDLSEDTFYDI 131 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,559 Number of Sequences: 317 Number of extensions: 5923 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 2 length of query: 523 length of database: 114,650 effective HSP length: 60 effective length of query: 463 effective length of database: 95,630 effective search space: 44276690 effective search space used: 44276690 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -