BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001126-TA|BGIBMGA001126-PA|IPR002005|Rab GTPase activator, IPR000632|Yeast Mrs6p protein (523 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 25 2.0 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 8.2 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 485 PGEEFLP-RAPNPEEIVFEDDVTHGPEFQR 513 P E+++P PN E+ +FE+ V G F + Sbjct: 149 PKEQYIPPELPNDEKSLFENGVEIGINFDK 178 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/34 (23%), Positives = 18/34 (52%) Query: 231 IAGGNNSLPCLEGVKECKKFLMSLGRYGNTPFLW 264 +A N++L + G+K K+ ++ N ++W Sbjct: 341 VAKNNDTLQFISGIKIIKQISSNIYERQNNEYIW 374 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,806 Number of Sequences: 429 Number of extensions: 7578 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 2 length of query: 523 length of database: 140,377 effective HSP length: 61 effective length of query: 462 effective length of database: 114,208 effective search space: 52764096 effective search space used: 52764096 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -