Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001125-TA|BGIBMGA001125-PA|undefined
         (296 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    23   7.8  

>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 12/47 (25%), Positives = 24/47 (51%)

Query: 201  QERRLSPCPSERLAPLASVGSVGPSYAVECEIASVGADSVFAEDEPD 247
            +++R++ CPS  +    +      S+++E  I+   ADS   E E +
Sbjct: 1616 RQKRMAVCPSSVVLAREAFKHPSESFSLEDPISEYYADSSDVEGESE 1662


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.316    0.133    0.388 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 240,857
Number of Sequences: 2123
Number of extensions: 8345
Number of successful extensions: 19
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 18
Number of HSP's gapped (non-prelim): 1
length of query: 296
length of database: 516,269
effective HSP length: 64
effective length of query: 232
effective length of database: 380,397
effective search space: 88252104
effective search space used: 88252104
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 48 (23.4 bits)