BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001125-TA|BGIBMGA001125-PA|undefined (296 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 7.8 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 7.8 Identities = 12/47 (25%), Positives = 24/47 (51%) Query: 201 QERRLSPCPSERLAPLASVGSVGPSYAVECEIASVGADSVFAEDEPD 247 +++R++ CPS + + S+++E I+ ADS E E + Sbjct: 1616 RQKRMAVCPSSVVLAREAFKHPSESFSLEDPISEYYADSSDVEGESE 1662 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.133 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,857 Number of Sequences: 2123 Number of extensions: 8345 Number of successful extensions: 19 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 1 length of query: 296 length of database: 516,269 effective HSP length: 64 effective length of query: 232 effective length of database: 380,397 effective search space: 88252104 effective search space used: 88252104 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -