BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001125-TA|BGIBMGA001125-PA|undefined (296 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 4.3 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 4.3 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 5.7 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/47 (27%), Positives = 19/47 (40%) Query: 5 DGWNGRDTNSAENSTENSHATERDRVRIEFYATYDVMTGVRIAATLG 51 DGW G+ A S S + + + +EFY + RI G Sbjct: 612 DGWGGKAGPCAIKSVVPSDESHWNDLAMEFYYNRSIPDHKRIVKLRG 658 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/47 (27%), Positives = 19/47 (40%) Query: 5 DGWNGRDTNSAENSTENSHATERDRVRIEFYATYDVMTGVRIAATLG 51 DGW G+ A S S + + + +EFY + RI G Sbjct: 650 DGWGGKAGPCAIKSVVPSDESHWNDLAMEFYYNRSIPDHKRIVKLRG 696 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 215 PLASVGSVGPSYAVECEI 232 PL + ++ SY ++CEI Sbjct: 47 PLIKLNNIPKSYGIKCEI 64 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,752 Number of Sequences: 429 Number of extensions: 2374 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 296 length of database: 140,377 effective HSP length: 57 effective length of query: 239 effective length of database: 115,924 effective search space: 27705836 effective search space used: 27705836 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -