BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001119-TA|BGIBMGA001119-PA|IPR002005|Rab GTPase activator (443 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 27 0.24 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 9.0 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 27.5 bits (58), Expect = 0.24 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 2 DEEYDVIVLGTGLKECILSGMLS-VSGKKVLHID 34 D YD IV+G G +++G LS VS KVL ++ Sbjct: 66 DLSYDFIVVGGGAARAVVAGRLSEVSNWKVLLLE 99 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 9.0 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 380 FVSVTDYYEPIDDGSQSQIFISESYDATTHF 410 F+SV +Y P D G + + IS T F Sbjct: 252 FLSVLVFYLPSDSGEKVSLSISILLSLTVFF 282 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,280 Number of Sequences: 429 Number of extensions: 5374 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 443 length of database: 140,377 effective HSP length: 60 effective length of query: 383 effective length of database: 114,637 effective search space: 43905971 effective search space used: 43905971 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -