BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001116-TA|BGIBMGA001116-PA|undefined (450 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 25 0.82 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.82 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.82 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 24 1.9 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 23 4.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 5.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 5.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 5.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 5.8 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 7.7 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 25.4 bits (53), Expect = 0.82 Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 214 LEINISKMWKDYIKSYDPDNL 234 L N +MWK+ YDPD + Sbjct: 88 LSHNKQQMWKELTAKYDPDGI 108 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.82 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 11/86 (12%) Query: 209 DKIAGLEINISKMWKDYIKSYDPDN--------LSATLPKSKRNIEVMQTETYHPQPTPP 260 D GLE +++K++K I +Y DN + +L R IE ++ Y P P Sbjct: 1072 DDEGGLEFSVNKLFKCMICTYKADNKENEQLRKIQESLRDLNRKIESLEKMQY-PDLRSP 1130 Query: 261 QEAFAPLSYPGSGHLV--NIAENYFQ 284 + GS V N+ +NY + Sbjct: 1131 AVSNVTTFMEGSKATVKNNVEDNYME 1156 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.82 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 11/86 (12%) Query: 209 DKIAGLEINISKMWKDYIKSYDPDN--------LSATLPKSKRNIEVMQTETYHPQPTPP 260 D GLE +++K++K I +Y DN + +L R IE ++ Y P P Sbjct: 1072 DDEGGLEFSVNKLFKCMICTYKADNKENEQLRKIQESLRDLNRKIESLEKMQY-PDLRSP 1130 Query: 261 QEAFAPLSYPGSGHLV--NIAENYFQ 284 + GS V N+ +NY + Sbjct: 1131 AVSNVTTFMEGSKATVKNNVEDNYME 1156 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 24.2 bits (50), Expect = 1.9 Identities = 9/36 (25%), Positives = 21/36 (58%) Query: 164 PSDNRGKNSHRRSGEVRLPADIIDQIKNHIYSIVHT 199 P + ++ +R ++RL D +D+ ++ IY +H+ Sbjct: 286 PVNQVPRDLNREVDQIRLSLDDMDRWRDRIYDAIHS 321 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 23.0 bits (47), Expect = 4.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 158 DDGIMFPSDNRGKNSHRRSGEVRLPA 183 DD I P D+ K+ G++ LPA Sbjct: 230 DDNISDPEDDDDKDQDMDEGDLPLPA 255 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 5.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 222 WKDYIKSYDPDNLSATLPKSKRNIE 246 W++YI + P L K K N+E Sbjct: 268 WENYISRHSPIPFIKKLGKIKENLE 292 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 5.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 222 WKDYIKSYDPDNLSATLPKSKRNIE 246 W++YI + P L K K N+E Sbjct: 268 WENYISRHSPIPFIKKLGKIKENLE 292 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 5.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 222 WKDYIKSYDPDNLSATLPKSKRNIE 246 W++YI + P L K K N+E Sbjct: 268 WENYISRHSPIPFIKKLGKIKENLE 292 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 5.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 222 WKDYIKSYDPDNLSATLPKSKRNIE 246 W++YI + P L K K N+E Sbjct: 268 WENYISRHSPIPFIKKLGKIKENLE 292 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 7.7 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Query: 239 PKSKRNIEVMQTETYHPQPTPPQ--EAFA 265 P +K +I + E P P PP E+FA Sbjct: 715 PGAKESISYLSMENNAPPPPPPPRVESFA 743 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.132 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,426 Number of Sequences: 317 Number of extensions: 4061 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 10 length of query: 450 length of database: 114,650 effective HSP length: 59 effective length of query: 391 effective length of database: 95,947 effective search space: 37515277 effective search space used: 37515277 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -