Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001115-TA|BGIBMGA001115-PA|IPR001173|Glycosyl
transferase, family 2
         (335 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    26   1.7  

>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 25.8 bits (54), Expect = 1.7
 Identities = 13/47 (27%), Positives = 19/47 (40%)

Query: 130 YGSDKVKCLELIKNRGKGGAVRLGIQSSRGATILFADADGASKFEDL 176
           Y +  +  L  + N G GG    G    R       ++D A+ F DL
Sbjct: 900 YSNSSINSLNSLDNYGDGGEAGTGDSGKRARMHALGNSDLANCFSDL 946


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.137    0.407 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 296,739
Number of Sequences: 2123
Number of extensions: 10448
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 335
length of database: 516,269
effective HSP length: 64
effective length of query: 271
effective length of database: 380,397
effective search space: 103087587
effective search space used: 103087587
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 48 (23.4 bits)