BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001114-TA|BGIBMGA001114-PA|undefined (83 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 20 4.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 19 6.2 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 19 6.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 19 6.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 19 8.3 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 19.8 bits (39), Expect = 4.7 Identities = 12/49 (24%), Positives = 18/49 (36%) Query: 34 GSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVERRNQQST 82 G + + GD VS E+ S P+ T++ QST Sbjct: 698 GIKRSGSHSWEGDSFKVSKHEEVSRTSTAGQFPTNVATTVTSMSIDQST 746 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 19.4 bits (38), Expect = 6.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Query: 46 DQITVSAEEDYPLASADEPVPSASQTSMVERRNQQSTD 83 D+ T + +ED L VP+ T V QS+D Sbjct: 1284 DKFTATYKEDVKLPCLAVGVPAPEVTWKVRGAVLQSSD 1321 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 19.4 bits (38), Expect = 6.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Query: 35 SHAASAQQQPG 45 S AAS Q QPG Sbjct: 210 SQAASQQSQPG 220 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 19.4 bits (38), Expect = 6.2 Identities = 7/25 (28%), Positives = 14/25 (56%) Query: 45 GDQITVSAEEDYPLASADEPVPSAS 69 GD ++ + DY S ++ +P +S Sbjct: 193 GDDLSSEWDSDYTDKSNEKKIPKSS 217 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 19.0 bits (37), Expect = 8.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 65 VPSASQTSMVERRNQQSTD 83 VPS Q ++ RNQ+ D Sbjct: 598 VPSLDQVWILNWRNQKDID 616 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.302 0.114 0.299 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,868 Number of Sequences: 429 Number of extensions: 661 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 83 length of database: 140,377 effective HSP length: 47 effective length of query: 36 effective length of database: 120,214 effective search space: 4327704 effective search space used: 4327704 T: 11 A: 40 X1: 17 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.2 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -