BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001114-TA|BGIBMGA001114-PA|undefined (83 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 30 0.22 At4g29950.2 68417.m04261 microtubule-associated protein identica... 29 0.51 At4g29950.1 68417.m04260 microtubule-associated protein identica... 29 0.51 At4g37440.1 68417.m05299 expressed protein 27 1.2 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 27 2.1 At3g16620.1 68416.m02124 chloroplast outer membrane protein, put... 26 2.7 At1g27920.1 68414.m03421 microtubule associated protein (MAP65/A... 26 2.7 At1g08680.2 68414.m00965 ARF GAP-like zinc finger-containing pro... 26 3.6 At1g08680.1 68414.m00964 ARF GAP-like zinc finger-containing pro... 26 3.6 At5g40450.1 68418.m04905 expressed protein 25 4.7 At5g24290.2 68418.m02858 integral membrane family protein contai... 25 4.7 At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME... 25 4.7 At2g28290.2 68415.m03434 chromatin remodeling protein, putative ... 25 6.3 At2g28290.1 68415.m03433 chromatin remodeling protein, putative ... 25 6.3 At2g20310.1 68415.m02372 expressed protein 25 6.3 At1g30470.1 68414.m03724 SIT4 phosphatase-associated family prot... 25 6.3 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 25 8.3 At5g43320.1 68418.m05294 casein kinase, putative similar to case... 25 8.3 At5g42390.1 68418.m05161 metalloendopeptidase identical to chlor... 25 8.3 At4g21210.1 68417.m03066 expressed protein contains Pfam domain ... 25 8.3 At4g11740.1 68417.m01872 ara4-interacting protein, putative (SAY... 25 8.3 At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:... 25 8.3 At1g06230.2 68414.m00659 DNA-binding bromodomain-containing prot... 25 8.3 At1g06230.1 68414.m00658 DNA-binding bromodomain-containing prot... 25 8.3 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 29.9 bits (64), Expect = 0.22 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 29 PSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVERRNQ 79 P S++ S ASA P D+ + E+ YPL EP+ A T M+ +Q Sbjct: 571 PISKLTSSLASAS--PADRTRMLGEQLYPLVERHEPLHVAKVTGMLLEMDQ 619 >At4g29950.2 68417.m04261 microtubule-associated protein identical to microtubule-associated protein GI:5032258 from [Arabidopsis thaliana]; similar to TBC1 domain family member 5 (Swiss-Prot:Q92609) [Homo sapiens]; contains Pfam profile PF00566: TBC domain Length = 703 Score = 28.7 bits (61), Expect = 0.51 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Query: 9 NRDVTSADVTLFKNIAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSA 68 N +S + LF + +S V S S QP + VS +D + D P+P + Sbjct: 489 NDSDSSNESNLFPDETVKDRETSVVDS-PLSISSQPSMEFIVSLSKDQETSVVDSPLPVS 547 Query: 69 SQTSMVERRNQQSTD 83 SQ S +E QS D Sbjct: 548 SQPS-IEFPVTQSND 561 >At4g29950.1 68417.m04260 microtubule-associated protein identical to microtubule-associated protein GI:5032258 from [Arabidopsis thaliana]; similar to TBC1 domain family member 5 (Swiss-Prot:Q92609) [Homo sapiens]; contains Pfam profile PF00566: TBC domain Length = 828 Score = 28.7 bits (61), Expect = 0.51 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Query: 9 NRDVTSADVTLFKNIAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSA 68 N +S + LF + +S V S S QP + VS +D + D P+P + Sbjct: 614 NDSDSSNESNLFPDETVKDRETSVVDS-PLSISSQPSMEFIVSLSKDQETSVVDSPLPVS 672 Query: 69 SQTSMVERRNQQSTD 83 SQ S +E QS D Sbjct: 673 SQPS-IEFPVTQSND 686 >At4g37440.1 68417.m05299 expressed protein Length = 471 Score = 27.5 bits (58), Expect = 1.2 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Query: 12 VTSADVTLFKNIAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQT 71 V S + ++F +A P + +S QQ+P + + E++ + S ++PV SAS + Sbjct: 304 VLSENPSIFP-LANTVNPLGAADVYTSSEQQKP--LLAIKNEDEKSIISEEKPVKSASVS 360 Query: 72 S-MVERRNQQSTD 83 S V + ++TD Sbjct: 361 SHHVSPEDDETTD 373 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 26.6 bits (56), Expect = 2.1 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 26 VSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSM 73 V TPSS G+ A PGD + +PL E P+ + TSM Sbjct: 448 VKTPSSVSGNELARFSDPPGD--ASLHDLFHPLDKVSEGKPNEASTSM 493 >At3g16620.1 68416.m02124 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1089 Score = 26.2 bits (55), Expect = 2.7 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 26 VSTPSSEVGSHAASAQQ--QPGDQITVSAEEDYPLASADEPVPSASQTSMVER 76 V EV A +Q+ +P T +ED+PLAS DE V +TS ER Sbjct: 33 VKDNEEEVFEEAIGSQEGLKPESLKTDVLQEDFPLASNDE-VCDLEETSRNER 84 >At1g27920.1 68414.m03421 microtubule associated protein (MAP65/ASE1) family protein low similarity to protein regulating cytokinesis 1 (PRC1) [Homo sapiens] GI:2865521; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 592 Score = 26.2 bits (55), Expect = 2.7 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Query: 22 NIAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVER 76 N++ + TPS+E+G+ D + + A D +A A E +AS+ ++E+ Sbjct: 367 NMSHMETPSTEMGNITNLVDSGEVDHVDLLAAMDEKIARAKE--EAASRKGIIEK 419 >At1g08680.2 68414.m00965 ARF GAP-like zinc finger-containing protein ZiGA4 (ZIGA4) nearly identical to ARF GAP-like zinc finger-containing protein ZiGA4 GI:10441354 from [Arabidopsis thaliana]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 648 Score = 25.8 bits (54), Expect = 3.6 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query: 35 SHAASAQQQPGDQIT-VSAEEDYPLASADEPVPSASQTSMV 74 S A + QQP + + +SA ++ AS D P+P+A T+++ Sbjct: 371 SFAGNLGQQPTSRPSELSAPKNEGWASFDNPMPAAKSTNVI 411 >At1g08680.1 68414.m00964 ARF GAP-like zinc finger-containing protein ZiGA4 (ZIGA4) nearly identical to ARF GAP-like zinc finger-containing protein ZiGA4 GI:10441354 from [Arabidopsis thaliana]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 649 Score = 25.8 bits (54), Expect = 3.6 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query: 35 SHAASAQQQPGDQIT-VSAEEDYPLASADEPVPSASQTSMV 74 S A + QQP + + +SA ++ AS D P+P+A T+++ Sbjct: 371 SFAGNLGQQPTSRPSELSAPKNEGWASFDNPMPAAKSTNVI 411 >At5g40450.1 68418.m04905 expressed protein Length = 2910 Score = 25.4 bits (53), Expect = 4.7 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 32 EVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVERRNQQS 81 ++ S A+ ++ D+IT EE + D PVP S+T + E + ++ Sbjct: 359 DIESKASLDHEEEMDKITKDTEEQEHVLVRDVPVPQ-SETLVTEAKTAET 407 >At5g24290.2 68418.m02858 integral membrane family protein contains Pfam domain PF01988: Integral membrane protein Length = 534 Score = 25.4 bits (53), Expect = 4.7 Identities = 14/56 (25%), Positives = 23/56 (41%) Query: 27 STPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVERRNQQST 82 + P+ E S AA+ P + + EED + A +P+ S S + T Sbjct: 41 NVPAREFRSKAAATAPAPVNTTEIELEEDNDGSQAQDPIVLESTVSETGSNEESET 96 >At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1729 Score = 25.4 bits (53), Expect = 4.7 Identities = 11/48 (22%), Positives = 27/48 (56%) Query: 32 EVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVERRNQ 79 ++ + A A+ Q D +T + + +P+A+ + P +Q + ++ +NQ Sbjct: 204 KLSTGAKLARDQQPDLLTRNQQCQFPVATQNTQFPMENQQAWLQMKNQ 251 >At2g28290.2 68415.m03434 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3529 Score = 25.0 bits (52), Expect = 6.3 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 4/80 (5%) Query: 5 QESNNRDVTSADVTLFKNIAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEP 64 +ES + SADV+L + + PS+ V ++PG T SA+ + +P Sbjct: 2799 EESKEPGIESADVSLHQLADIQAEPSNLVDQMDIEESKEPG---TESADVSLHQLADIQP 2855 Query: 65 VPSASQTSM-VERRNQQSTD 83 PS M E+ + T+ Sbjct: 2856 GPSILVDQMDTEKSKEPGTE 2875 >At2g28290.1 68415.m03433 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3574 Score = 25.0 bits (52), Expect = 6.3 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 4/80 (5%) Query: 5 QESNNRDVTSADVTLFKNIAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEP 64 +ES + SADV+L + + PS+ V ++PG T SA+ + +P Sbjct: 2799 EESKEPGIESADVSLHQLADIQAEPSNLVDQMDIEESKEPG---TESADVSLHQLADIQP 2855 Query: 65 VPSASQTSM-VERRNQQSTD 83 PS M E+ + T+ Sbjct: 2856 GPSILVDQMDTEKSKEPGTE 2875 >At2g20310.1 68415.m02372 expressed protein Length = 430 Score = 25.0 bits (52), Expect = 6.3 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 29 PSSEVGSHAASAQQQPG--DQITVSAEEDYPLASADEPVPSASQTSMVERRNQ 79 P + SH A+ QQQPG + + + ++ + P P+ + + E NQ Sbjct: 362 PLTAEDSHTATVQQQPGINENVLETKLSEFEKWLMENPNPTGPVSPLPEPGNQ 414 >At1g30470.1 68414.m03724 SIT4 phosphatase-associated family protein contains similarity to copper chaperone homolog CCH GB:AAF15286 GI:6525011 from [Glycine max]; contains Pfam profile PF04499: SIT4 phosphatase-associated protein Length = 811 Score = 25.0 bits (52), Expect = 6.3 Identities = 13/47 (27%), Positives = 20/47 (42%) Query: 36 HAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVERRNQQST 82 +A +A P D T + +P + EP P S + R +ST Sbjct: 630 NATAASSPPVDMETEDSTSKHPSENPSEPEPEKSPAWVEWRETSEST 676 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 24.6 bits (51), Expect = 8.3 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 23 IAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPL--ASADEPVPSASQ 70 + F+S S+ A + Q+ G I+V+ +D+P S DE + A + Sbjct: 77 VNFISEDSANSAISAMNGQELNGFNISVNVAKDWPSLPLSLDESIEEAEK 126 >At5g43320.1 68418.m05294 casein kinase, putative similar to casein kinase I (CKI2) [Arabidopsis thaliana] gi|1103322|emb|CAA55397; contains protein kinase domain, Pfam:PF00069 Length = 480 Score = 24.6 bits (51), Expect = 8.3 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Query: 2 SHHQESNNRDVTSADVTLFKNIAFVSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASA 61 S + S N +S D T +N V P S HA+S+++ + ++ D+ + Sbjct: 364 SRPRTSENVLASSKDTTP-QNYERVERPISST-RHASSSRKAVVSSVRATSSADFTENRS 421 Query: 62 DEPVPSASQTSMVER 76 VPS ++S +R Sbjct: 422 SRVVPSNGRSSTAQR 436 >At5g42390.1 68418.m05161 metalloendopeptidase identical to chloroplast processing enzyme metalloendopeptidase [Arabidopsis thaliana] gi|2827039|gb|AAC39482 Length = 1265 Score = 24.6 bits (51), Expect = 8.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 40 AQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVER 76 A Q G++ITV +EE+ P VP +SM R Sbjct: 1226 AGAQAGEEITVLSEEEEPEDVFSGVVPVGRGSSMTTR 1262 >At4g21210.1 68417.m03066 expressed protein contains Pfam domain PF03618: Domain of unknown function (DUF299) Length = 403 Score = 24.6 bits (51), Expect = 8.3 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 7 SNNRDVTSADVTLFKNIAFVSTPSSEVGSHAASA 40 S++ V+ AD+T K+I VS + HA +A Sbjct: 102 SSSNGVSEADMTAAKSIYIVSDGTGWTAEHAVNA 135 >At4g11740.1 68417.m01872 ara4-interacting protein, putative (SAY1) similar to Ara4-interacting protein [Arabidopsis thaliana] GI:13160609; contains Pfam profiles PF00789: UBX domain, PF02809: Ubiquitin interaction motif Length = 564 Score = 24.6 bits (51), Expect = 8.3 Identities = 12/52 (23%), Positives = 25/52 (48%) Query: 30 SSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVERRNQQS 81 +SE+G+ A +A Q P D ++ P + D+ + +V R +++ Sbjct: 260 TSEIGASAVTAAQGPQDTQALNGRLAAPSSPFDDDSDDVDEQPLVRHRPRRA 311 >At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:4586626 Length = 1207 Score = 24.6 bits (51), Expect = 8.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Query: 48 ITVSAEEDYPLASADEPVPSASQTSMV 74 +TVS D PL SA PV AS S+V Sbjct: 287 VTVSKYMDSPLLSAALPVFDASNKSIV 313 >At1g06230.2 68414.m00659 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 766 Score = 24.6 bits (51), Expect = 8.3 Identities = 14/51 (27%), Positives = 21/51 (41%) Query: 26 VSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVER 76 + PS + + I VS+EED + AD + A + VER Sbjct: 184 IEAPSQTLSLEDGDTLVVDKNPIEVSSEEDVHVIDADNLIKEAHPENFVER 234 >At1g06230.1 68414.m00658 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 766 Score = 24.6 bits (51), Expect = 8.3 Identities = 14/51 (27%), Positives = 21/51 (41%) Query: 26 VSTPSSEVGSHAASAQQQPGDQITVSAEEDYPLASADEPVPSASQTSMVER 76 + PS + + I VS+EED + AD + A + VER Sbjct: 184 IEAPSQTLSLEDGDTLVVDKNPIEVSSEEDVHVIDADNLIKEAHPENFVER 234 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.302 0.114 0.299 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,704,880 Number of Sequences: 28952 Number of extensions: 53814 Number of successful extensions: 128 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 115 Number of HSP's gapped (non-prelim): 24 length of query: 83 length of database: 12,070,560 effective HSP length: 62 effective length of query: 21 effective length of database: 10,275,536 effective search space: 215786256 effective search space used: 215786256 T: 11 A: 40 X1: 17 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -