BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001113-TA|BGIBMGA001113-PA|undefined (87 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-lik... 21 6.5 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 21 6.5 >Z32645-1|CAA83567.1| 258|Anopheles gambiae chymotrypsinogen-like protease ANCHYM2 protein. Length = 258 Score = 21.0 bits (42), Expect = 6.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 21 VGLLKQRIPVNLTRLSVYLGRSSDGLRLPT 50 V L++ +PVN T GR+S +PT Sbjct: 138 VEYLEKAVPVNATVRLTGWGRTSTNGNVPT 167 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 21.0 bits (42), Expect = 6.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 68 QQKDKQSLYKQNDAIK 83 ++KD Q LY++N IK Sbjct: 11 ERKDIQGLYRENVPIK 26 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.133 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,365 Number of Sequences: 2123 Number of extensions: 2646 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 87 length of database: 516,269 effective HSP length: 53 effective length of query: 34 effective length of database: 403,750 effective search space: 13727500 effective search space used: 13727500 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -