BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001113-TA|BGIBMGA001113-PA|undefined (87 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 0.72 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 2.2 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 20 5.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 20 5.1 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 20 5.1 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 20 5.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 5.1 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.6 bits (46), Expect = 0.72 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 63 MTIANQQKDKQSLYKQN 79 M I+N DKQSL K+N Sbjct: 370 MKISNLSFDKQSLLKEN 386 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.0 bits (42), Expect = 2.2 Identities = 16/55 (29%), Positives = 22/55 (40%) Query: 31 NLTRLSVYLGRSSDGLRLPTSTVYVYDYSLPKMTIANQQKDKQSLYKQNDAIKIS 85 NL + LG L +T YDYSL ++ A + L + D IS Sbjct: 333 NLHGMPGILGGIFGALMAALATEASYDYSLYEIFPARAPNSETKLAEMRDNYGIS 387 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 19.8 bits (39), Expect = 5.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 40 GRSSDGLRLPTSTVYVYDYSLPKMTIANQQKDKQSLYKQND 80 G S L T+ +Y + + N ++ + S Y+QND Sbjct: 252 GISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQND 292 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 19.8 bits (39), Expect = 5.1 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Query: 48 LPTSTVYVYDYSLPKMTIANQQKDKQSLYKQNDA----IKISRK 87 LPTST LPK + K K + + +D KI+RK Sbjct: 367 LPTSTYSGSPTELPKHLPTSLTKSKMEVMELSDLHHPNCKINRK 410 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 19.8 bits (39), Expect = 5.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 40 GRSSDGLRLPTSTVYVYDYSLPKMTIANQQKDKQSLYKQND 80 G S L T+ +Y + + N ++ + S Y+QND Sbjct: 252 GISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQND 292 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 19.8 bits (39), Expect = 5.1 Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 40 GRSSDGLRLPTSTVYVYDYSLPKMTIANQQKDKQSLYKQND 80 G S L T+ +Y + + N ++ + S Y+QND Sbjct: 252 GISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQND 292 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 19.8 bits (39), Expect = 5.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 40 GRSSDGLRLPTSTV 53 G SDG+RLP V Sbjct: 381 GLDSDGIRLPCREV 394 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,251 Number of Sequences: 429 Number of extensions: 648 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 87 length of database: 140,377 effective HSP length: 48 effective length of query: 39 effective length of database: 119,785 effective search space: 4671615 effective search space used: 4671615 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.8 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -