GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001110-TA|BGIBMGA001110-PA|IPR013098|Immunoglobulin
I-set, IPR007110|Immunoglobulin-like, IPR003599|Immunoglobulin
subtype, IPR003598|Immunoglobulin subtype 2
         (178 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF513635-1|AAM53607.1|  212|Anopheles gambiae glutathione S-tran...    22   9.4  

>AF513635-1|AAM53607.1|  212|Anopheles gambiae glutathione
           S-transferase D4 protein.
          Length = 212

 Score = 22.2 bits (45), Expect = 9.4
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 81  VPIVKLRLGSKLNPNDIEEGDDVYFECVVEANPPAYKVVWEHNGQIM 127
           V +V  +LG KLN   I   D V  + + + NP     +   NG ++
Sbjct: 15  VILVAKKLGIKLNLRKINIYDPVAMDTLSKLNPHHILPMLVDNGTVV 61


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.131    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 195,582
Number of Sequences: 2123
Number of extensions: 7561
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 178
length of database: 516,269
effective HSP length: 60
effective length of query: 118
effective length of database: 388,889
effective search space: 45888902
effective search space used: 45888902
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 45 (22.2 bits)