BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001108-TA|BGIBMGA001108-PA|IPR013151|Immunoglobulin, IPR007110|Immunoglobulin-like (149 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032660-1|CAA21752.1| 711|Caenorhabditis elegans Hypothetical ... 30 0.60 AF003142-2|AAB54190.1| 412|Caenorhabditis elegans Hypothetical ... 30 0.79 U41992-2|AAV28347.2| 148|Caenorhabditis elegans Hypothetical pr... 27 5.6 U58755-2|AAB00692.1| 362|Caenorhabditis elegans Hypothetical pr... 26 9.8 >AL032660-1|CAA21752.1| 711|Caenorhabditis elegans Hypothetical protein Y70G10A.2 protein. Length = 711 Score = 30.3 bits (65), Expect = 0.60 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 77 YQWIVPQK-PQDMGILRGRVDLTYRASNDPL 106 Y VP K P+D+G L GR++L A+ DPL Sbjct: 605 YMNTVPHKDPRDIGKLNGRLELVTLAAEDPL 635 >AF003142-2|AAB54190.1| 412|Caenorhabditis elegans Hypothetical protein F57C9.7 protein. Length = 412 Score = 29.9 bits (64), Expect = 0.79 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 84 KPQDMGILRGRVDLTYRASNDPLKMHRALRIVKPNTDISGDYTCVVSTFMEEDSRTKQMT 143 +PQ M R R L R P + + RI +P+ +++ DYTC TF E+ K +T Sbjct: 141 EPQAMPKQRRR-RLYRRKMTRPQGVPKRRRIKRPDLELADDYTC--DTFAEQGLTLKSLT 197 >U41992-2|AAV28347.2| 148|Caenorhabditis elegans Hypothetical protein F32E10.9 protein. Length = 148 Score = 27.1 bits (57), Expect = 5.6 Identities = 15/63 (23%), Positives = 27/63 (42%) Query: 72 NARPVYQWIVPQKPQDMGILRGRVDLTYRASNDPLKMHRALRIVKPNTDISGDYTCVVST 131 ++R +++ + P I+ GRV + A+ + NTD+SGD Sbjct: 12 SSRKIFESAAAKFPNCQAIITGRVIVEENANRGAEAEKLTRDFITKNTDVSGDELIKFIN 71 Query: 132 FME 134 +ME Sbjct: 72 YME 74 >U58755-2|AAB00692.1| 362|Caenorhabditis elegans Hypothetical protein C34D4.10 protein. Length = 362 Score = 26.2 bits (55), Expect = 9.8 Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 79 WIVPQKPQDMGILRGRVDLTYRASNDPLKMHRAL 112 W V + D+GI+R R D S DPL + AL Sbjct: 210 WPVGVETCDIGIMRSRTDFKPLGSLDPLLDYPAL 243 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.323 0.138 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,803,219 Number of Sequences: 27539 Number of extensions: 146224 Number of successful extensions: 295 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 292 Number of HSP's gapped (non-prelim): 4 length of query: 149 length of database: 12,573,161 effective HSP length: 75 effective length of query: 74 effective length of database: 10,507,736 effective search space: 777572464 effective search space used: 777572464 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -