BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001108-TA|BGIBMGA001108-PA|IPR013151|Immunoglobulin, IPR007110|Immunoglobulin-like (149 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0266 - 16582912-16584918,16585041-16585229 27 8.3 09_04_0197 - 15522167-15523524,15525416-15525683 27 8.3 02_02_0188 + 7617838-7620231,7621856-7622071,7622167-7622328,762... 27 8.3 >12_02_0266 - 16582912-16584918,16585041-16585229 Length = 731 Score = 26.6 bits (56), Expect = 8.3 Identities = 18/56 (32%), Positives = 27/56 (48%) Query: 38 EIIQYGVQDAVILDCDYTYGNNTSGLMVKWFFKNNARPVYQWIVPQKPQDMGILRG 93 EII V +V+ + TYG++TS L +K R ++ + Q QD L G Sbjct: 630 EIIIDSVSFSVLKELKLTYGSSTSSLSIKPGAMPKLRIMHLIVFGQAEQDTKSLYG 685 >09_04_0197 - 15522167-15523524,15525416-15525683 Length = 541 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/42 (33%), Positives = 23/42 (54%) Query: 42 YGVQDAVILDCDYTYGNNTSGLMVKWFFKNNARPVYQWIVPQ 83 YG ++ V + D YG + +++ N+AR YQ I+PQ Sbjct: 164 YGWREVVPIYIDTDYGRSIIPDLLEALQGNDARVPYQSIIPQ 205 >02_02_0188 + 7617838-7620231,7621856-7622071,7622167-7622328, 7622466-7622516,7622936-7623070,7623161-7623184, 7623341-7623452,7623776-7623901,7624004-7624053, 7624339-7624497,7624582-7624677,7624751-7624866, 7624907-7624984,7624985-7625108,7625193-7625306, 7625423-7625503,7625616-7625756,7625834-7625848 Length = 1397 Score = 26.6 bits (56), Expect = 8.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Query: 56 YGNNTSGLMVKWFFKNNARPVYQWIVPQK 84 Y + T+G + KW F+ N R W K Sbjct: 603 YEHMTNGSLDKWIFRKNPRGTLSWATRYK 631 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.323 0.138 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,298,820 Number of Sequences: 37544 Number of extensions: 159762 Number of successful extensions: 216 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 213 Number of HSP's gapped (non-prelim): 3 length of query: 149 length of database: 14,793,348 effective HSP length: 76 effective length of query: 73 effective length of database: 11,940,004 effective search space: 871620292 effective search space used: 871620292 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -