BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001107-TA|BGIBMGA001107-PA|IPR002048|Calcium-binding EF-hand (322 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 3.0 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 4.0 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 5.2 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 5.2 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.1 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Query: 148 NSEGF--TYSNLQKRDRRRWTYADADQNDAL 176 N GF ++S L KR +W Y + ND L Sbjct: 219 NWAGFADSHSPLYKRPHDQWAYEKLNVNDGL 249 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 21 NEETKRLMDHLSDAEH 36 NEETKRL++ L H Sbjct: 147 NEETKRLVEDLEAESH 162 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/9 (66%), Positives = 8/9 (88%) Query: 111 HWRQQNPNN 119 HWR+ NPN+ Sbjct: 387 HWRKNNPND 395 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/34 (26%), Positives = 16/34 (47%) Query: 64 SPEESKRRLGEIADKIDSDQDGFITLVELKDWIR 97 +P S +LG++ D + D + E DW + Sbjct: 203 TPRRSGCKLGQVFDDVGKKCDWVRNVPECADWYK 236 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/21 (38%), Positives = 9/21 (42%) Query: 112 WRQQNPNNEEFVTWEAYRKNV 132 W NPN E W KN+ Sbjct: 663 WLNHNPNYAEVTDWYTGWKNM 683 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,064 Number of Sequences: 317 Number of extensions: 3484 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 5 length of query: 322 length of database: 114,650 effective HSP length: 57 effective length of query: 265 effective length of database: 96,581 effective search space: 25593965 effective search space used: 25593965 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -