BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001107-TA|BGIBMGA001107-PA|IPR002048|Calcium-binding EF-hand (322 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 25 3.8 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 23 8.7 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 24.6 bits (51), Expect = 3.8 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Query: 33 DAEHYRNEHHNKQFDHDAFLGEDQAK 58 D EH+ N +QFD D F E +AK Sbjct: 407 DPEHFPNP---EQFDPDRFTAEQEAK 429 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 23.4 bits (48), Expect = 8.7 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 54 EDQAKTFDQLSPEESKRRLGEIADKIDSDQDGFITLVELK 93 E+ AK ++ ++ + +GE K+ Q+G + L+ELK Sbjct: 128 EELAKLLKEMKQSDALKSVGETISKVRRAQNGGM-LLELK 166 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 352,756 Number of Sequences: 2123 Number of extensions: 15730 Number of successful extensions: 64 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 64 Number of HSP's gapped (non-prelim): 2 length of query: 322 length of database: 516,269 effective HSP length: 64 effective length of query: 258 effective length of database: 380,397 effective search space: 98142426 effective search space used: 98142426 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -