GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001106-TA|BGIBMGA001106-PA|IPR008991|Translation protein
SH3-like, IPR001147|Ribosomal protein L21e
         (159 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    21   7.8  

>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 20.6 bits (41), Expect = 7.8
 Identities = 14/63 (22%), Positives = 26/63 (41%)

Query: 49  QKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKR 108
           +KG   K    K  R ++    A  V    ++ GR + +RI   V     +   Q + ++
Sbjct: 428 KKGRDKKSTSKKPRRKFHFKQIARAVKFTSKLFGRALSRRIKATVLFATETGTSQMYAEK 487

Query: 109 VKE 111
           + E
Sbjct: 488 LSE 490


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.138    0.404 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,062
Number of Sequences: 429
Number of extensions: 1806
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 159
length of database: 140,377
effective HSP length: 53
effective length of query: 106
effective length of database: 117,640
effective search space: 12469840
effective search space used: 12469840
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 41 (20.6 bits)