BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001105-TA|BGIBMGA001105-PA|undefined (292 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 23 2.0 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 3.5 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 8.2 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 8.2 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 33 ERVGKDSIKNFDCCSLTLQPCRNPVVTKEGYLFDKEAI 70 ER K+S++ + L + V T++GYL K+ I Sbjct: 49 ERCIKESLRLYPSVHLISRALGEDVRTQKGYLIPKDTI 86 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/38 (23%), Positives = 17/38 (44%) Query: 113 KFMNREKNISSTTPSTSAIEEKTINSVSNIANGKEKQL 150 + + EK + P + + + +V+NI KQL Sbjct: 185 RIIEAEKRVECNDPLVALVVNENNTTVNNICQATHKQL 222 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/31 (25%), Positives = 17/31 (54%) Query: 215 PVTHDILSNAVPCAVIRTSGHVVTMECVEKI 245 P+TH+I N P I S +++ + ++ + Sbjct: 337 PLTHNIAHNPYPSHSIYPSSNLMPLNNIQNL 367 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Query: 173 TVYCPISGKPLKMKDLIE-VKWTLVNDPDDKKSLIAKENRYMC 214 T +CP KD E V W N +++ + + +N+Y C Sbjct: 84 TCHCPYG---YTGKDCGEYVDWCSTNPCENQATCVQNKNQYQC 123 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.131 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,474 Number of Sequences: 317 Number of extensions: 2740 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 4 length of query: 292 length of database: 114,650 effective HSP length: 56 effective length of query: 236 effective length of database: 96,898 effective search space: 22867928 effective search space used: 22867928 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -