BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001104-TA|BGIBMGA001104-PA|undefined (56 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1604.17c |||conserved fungal protein|Schizosaccharomyces pom... 25 1.2 SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces... 24 2.1 SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p... 23 3.7 SPAC630.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 23 6.4 SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosacch... 23 6.4 SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2... 22 8.5 >SPBC1604.17c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 25.0 bits (52), Expect = 1.2 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Query: 6 VPPEPERASESAKQAIERHNRLKRWLVTHLYLFPRDVRASSS 47 +PP+ + +S K +E + K +L++HL + D ++SSS Sbjct: 181 LPPDKFHSDQS-KALLEPKWKTKNYLISHLIFWIIDQQSSSS 221 >SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 24.2 bits (50), Expect = 2.1 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 8 PEPERASESAKQAIERH-NRLKRWLVTHLYLFPRDVRASSSNSSATDV 54 P R ++++++R+ R+K +L HL +FPR ATDV Sbjct: 96 PVDHRRRNRSEESLQRNVERIKVYLA-HLIVFPRKA-GQPKKGDATDV 141 >SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 23.4 bits (48), Expect = 3.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 8 PEPERASESAKQAIERHNRLKRW 30 P P + + S K E R KRW Sbjct: 153 PPPRKMTSSEKTRSENRERKKRW 175 >SPAC630.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 22.6 bits (46), Expect = 6.4 Identities = 11/40 (27%), Positives = 16/40 (40%) Query: 3 KCHVPPEPERASESAKQAIERHNRLKRWLVTHLYLFPRDV 42 KC P S +K + R RWL + + RD+ Sbjct: 68 KCESEENPNFESYHSKVGKKSCKRFMRWLKANAFAEERDI 107 >SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 461 Score = 22.6 bits (46), Expect = 6.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 14 SESAKQAIERHNRLKRWLVTHLYLFPRDV 42 S + +Q +ER+ L +WL L P+ V Sbjct: 422 SLTKEQLLERYPNLSKWLSLRKLLDPKGV 450 >SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 22.2 bits (45), Expect = 8.5 Identities = 9/32 (28%), Positives = 17/32 (53%) Query: 23 RHNRLKRWLVTHLYLFPRDVRASSSNSSATDV 54 + N+ W+ +L+ R+ +SSS+ DV Sbjct: 83 KSNKALTWITDSAFLYAREDNSSSSSILLFDV 114 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.316 0.125 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,022 Number of Sequences: 5004 Number of extensions: 5917 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 6 length of query: 56 length of database: 2,362,478 effective HSP length: 37 effective length of query: 19 effective length of database: 2,177,330 effective search space: 41369270 effective search space used: 41369270 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -