BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001103-TA|BGIBMGA001103-PA|undefined (159 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 22 2.8 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 22 2.8 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 22 2.8 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 5.0 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 20 8.7 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Query: 69 KLEMWKKELRNKVAKKTAEAQAAKDKKERLVEEVRRH 105 ++++W + R K+ K+ + ++ R EE RH Sbjct: 49 QIKIWFQNRRMKLKKELRAVKEINEQARREREEQERH 85 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Query: 69 KLEMWKKELRNKVAKKTAEAQAAKDKKERLVEEVRRH 105 ++++W + R K+ K+ + ++ R EE RH Sbjct: 200 QIKIWFQNRRMKLKKELRAVKEINEQARREREEQERH 236 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Query: 69 KLEMWKKELRNKVAKKTAEAQAAKDKKERLVEEVRRH 105 ++++W + R K+ K+ + ++ R EE RH Sbjct: 259 QIKIWFQNRRMKLKKELRAVKEINEQARREREEQERH 295 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.0 bits (42), Expect = 5.0 Identities = 12/53 (22%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Query: 73 WKKELRN-KVAKKTAEAQAAKDKKERL----VEEVRRHFGFKLDSRDERFQEM 120 W+K +N + AK++ +A+ AK+ + + +E H F D+ + +++ Sbjct: 139 WEKRRKNNEAAKRSRDARRAKEDEIAIRCAFLERENCHLKFVTDTLKKELEKL 191 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 20.2 bits (40), Expect = 8.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Query: 42 METTRQKRLAEEEKILKRDQEIVAKMAKLEMW 73 M+TT +K + E IL D+ + +W Sbjct: 239 MQTTNEKEIFERLSILPVDEFLQISEEVANIW 270 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.126 0.344 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,351 Number of Sequences: 317 Number of extensions: 747 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 159 length of database: 114,650 effective HSP length: 52 effective length of query: 107 effective length of database: 98,166 effective search space: 10503762 effective search space used: 10503762 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -