BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001094-TA|BGIBMGA001094-PA|undefined (77 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.099 SB_33615| Best HMM Match : PA (HMM E-Value=9e-16) 25 8.6 >SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 31.5 bits (68), Expect = 0.099 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 7/74 (9%) Query: 10 RGRFGAHFPFNFGFITS--VDGRSNARDFVYV----IKQWLVYMPHGNVANWV-VWIGWE 62 RG +GA +P + G TS D +N R+++ +QW + P + ++ +G+ Sbjct: 272 RGVYGAAYPLHEGLSTSYPTDSSANHREYLQYSWASFRQWYRFQPLNEIKSYFGTRVGFY 331 Query: 63 TGFKGKYNVIYLLS 76 + G YN++ +++ Sbjct: 332 FAWLGTYNLMLVIA 345 >SB_33615| Best HMM Match : PA (HMM E-Value=9e-16) Length = 629 Score = 25.0 bits (52), Expect = 8.6 Identities = 7/23 (30%), Positives = 14/23 (60%) Query: 39 VIKQWLVYMPHGNVANWVVWIGW 61 ++ +L Y P G V W+V++ + Sbjct: 40 LVSPFLAYAPSGTVEGWLVYVNY 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.328 0.146 0.510 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,871,155 Number of Sequences: 59808 Number of extensions: 99899 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 164 Number of HSP's gapped (non-prelim): 2 length of query: 77 length of database: 16,821,457 effective HSP length: 55 effective length of query: 22 effective length of database: 13,532,017 effective search space: 297704374 effective search space used: 297704374 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -