BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001094-TA|BGIBMGA001094-PA|undefined (77 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97405-11|AAB53004.1| 672|Caenorhabditis elegans Hypothetical p... 25 6.4 AL021482-2|CAA16339.1| 1003|Caenorhabditis elegans Hypothetical ... 25 8.4 >U97405-11|AAB53004.1| 672|Caenorhabditis elegans Hypothetical protein T09B4.1 protein. Length = 672 Score = 25.0 bits (52), Expect = 6.4 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 43 WLVYMPHGNVANWVVWIGWETGFKGKYNVIYLLSY 77 W + G + +V W+ G++GK IY+L Y Sbjct: 623 WQYFESPGILPFFVFRRVWQDGWRGKLLYIYILGY 657 >AL021482-2|CAA16339.1| 1003|Caenorhabditis elegans Hypothetical protein Y39A1B.2 protein. Length = 1003 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 13 FGAHFPFNFGFITSVDGRSNARDFVYVI 40 F AH +NF ++DG R+ +Y + Sbjct: 776 FAAHLAYNFAKGQNMDGSERMRNALYAV 803 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.328 0.146 0.510 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,168,226 Number of Sequences: 27539 Number of extensions: 76784 Number of successful extensions: 148 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 146 Number of HSP's gapped (non-prelim): 2 length of query: 77 length of database: 12,573,161 effective HSP length: 57 effective length of query: 20 effective length of database: 11,003,438 effective search space: 220068760 effective search space used: 220068760 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -