BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001093-TA|BGIBMGA001093-PA|IPR003698|Lipoate synthase, IPR007197|Radical SAM, IPR006638|Elongator protein 3/MiaB/NifB (366 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 2.6 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 4.6 AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. 22 8.0 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/45 (24%), Positives = 19/45 (42%) Query: 56 GKLKREKGESERLRLPPWLKTTIPTGSKFNEIKQQLRSLKLSTVC 100 G L+ KG + + PP IP G N + + ++ +C Sbjct: 425 GILRYAKGPYQPSQAPPTYDYGIPQGVVLNPLDARCNEIRPDAIC 469 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 4.6 Identities = 14/60 (23%), Positives = 14/60 (23%) Query: 100 CEEARCPNIGECWSGGKHGASTATIMLMGDTCTRGCMFCSVKTSRNPPPLDPEEPRNTAH 159 C E C N G C G T G C C N T H Sbjct: 27 CTETSCMNGGTCIDGINSYICTCKPGFTGSNCQNRINLCDSSPCLNGATCQDHTTHYTCH 86 >AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. Length = 46 Score = 21.8 bits (44), Expect = 8.0 Identities = 6/21 (28%), Positives = 15/21 (71%) Query: 264 PDLITKSSIMLGLGETDAQVE 284 PD+ T+ + + +G T+A+++ Sbjct: 22 PDVFTREELAMKIGLTEARIQ 42 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,197 Number of Sequences: 317 Number of extensions: 3408 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 366 length of database: 114,650 effective HSP length: 58 effective length of query: 308 effective length of database: 96,264 effective search space: 29649312 effective search space used: 29649312 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -