Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001092-TA|BGIBMGA001092-PA|IPR004153|CXCXC repeat,
IPR000072|Platelet-derived growth factor (PDGF)
         (195 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase p...    23   4.6  

>AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 23.4 bits (48), Expect = 4.6
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 68  VQL-KPNSPHELVSPSAVWVKNCVGI---CDYDNEGSCIATETKIRHIP 112
           +QL K N+P  ++     W ++ V +    D+  EG+  AT T I+H P
Sbjct: 439 IQLNKANAPVNILL--TFWQRSQVNLGTGLDFGPEGNLFATFTHIQHAP 485


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.322    0.137    0.442 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 213,070
Number of Sequences: 2123
Number of extensions: 9549
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 19
Number of HSP's gapped (non-prelim): 1
length of query: 195
length of database: 516,269
effective HSP length: 61
effective length of query: 134
effective length of database: 386,766
effective search space: 51826644
effective search space used: 51826644
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 46 (22.6 bits)