BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001092-TA|BGIBMGA001092-PA|IPR004153|CXCXC repeat, IPR000072|Platelet-derived growth factor (PDGF) (195 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizos... 27 2.4 SPBC4B4.01c |||fumble family pantothenate kinase |Schizosaccharo... 25 5.6 SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||... 25 7.4 SPCC24B10.10c |||mitochondrial outer membrane ATPase Msp1 |Schiz... 25 9.7 >SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 26.6 bits (56), Expect = 2.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 70 LKPNSPHELVSPSAVWVKNCVGICDYDNEGSCIATETKIR 109 LKP PH P++++ N + + DY ++ + ++R Sbjct: 94 LKPKKPHTTPKPASIYTFNELVVLDYPHKDRALRYLERLR 133 >SPBC4B4.01c |||fumble family pantothenate kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 403 Score = 25.4 bits (53), Expect = 5.6 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 55 MEKSRCGEPKDVFVQLKPNSPHELVSPSAVWVKNCVGICDYDNEG 99 M ++ CG + + N +L P +VW+ N G +NEG Sbjct: 1 MSETECGRFSTISRETISNVERQLSQPPSVWL-NLTGARIIENEG 44 >SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 710 Score = 25.0 bits (52), Expect = 7.4 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Query: 29 LGEPFRIGEYIKVVCTSELSNERDHIMEKSRCGEPK-----DVFVQLKPNSPHELVSPSA 83 +G P + V T+ +SN+++H + +P+ D + P+ P+ + PS Sbjct: 324 MGSPTKEKSQWGSVSTTGVSNQQNHPAAWNPDNKPQSIVHWDSLRESSPSIPNSPIDPSN 383 Query: 84 VWVKN 88 ++VKN Sbjct: 384 LYVKN 388 >SPCC24B10.10c |||mitochondrial outer membrane ATPase Msp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 355 Score = 24.6 bits (51), Expect = 9.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 36 GEYIKVVCTSELSNERDHIMEK 57 G YIK VC S LS R + +K Sbjct: 294 GSYIKEVCRSALSVPRRELFDK 315 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.322 0.137 0.442 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 906,019 Number of Sequences: 5004 Number of extensions: 38921 Number of successful extensions: 50 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 48 Number of HSP's gapped (non-prelim): 4 length of query: 195 length of database: 2,362,478 effective HSP length: 69 effective length of query: 126 effective length of database: 2,017,202 effective search space: 254167452 effective search space used: 254167452 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -