BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001092-TA|BGIBMGA001092-PA|IPR004153|CXCXC repeat,
IPR000072|Platelet-derived growth factor (PDGF)
(195 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 23 4.6
>AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase
protein.
Length = 684
Score = 23.4 bits (48), Expect = 4.6
Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 6/49 (12%)
Query: 68 VQL-KPNSPHELVSPSAVWVKNCVGI---CDYDNEGSCIATETKIRHIP 112
+QL K N+P ++ W ++ V + D+ EG+ AT T I+H P
Sbjct: 439 IQLNKANAPVNILL--TFWQRSQVNLGTGLDFGPEGNLFATFTHIQHAP 485
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.322 0.137 0.442
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 213,070
Number of Sequences: 2123
Number of extensions: 9549
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 19
Number of HSP's gapped (non-prelim): 1
length of query: 195
length of database: 516,269
effective HSP length: 61
effective length of query: 134
effective length of database: 386,766
effective search space: 51826644
effective search space used: 51826644
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -