BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001091-TA|BGIBMGA001091-PA|IPR002861|Reeler region, IPR009465|Spondin, N-terminal, IPR000884|Thrombospondin, type I, IPR002223|Proteinase inhibitor I2, Kunitz metazoa, IPR000437|Prokaryotic membrane lipoprotein lipid attachment site (744 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 27 1.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 26 4.1 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 27.5 bits (58), Expect = 1.4 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 337 RMYRITPMFPEDPRAPFYDPDSKTMAPMARLYLTREKL 374 R +R +P P YDP T+AP A YL EKL Sbjct: 473 RKFRFSPS-ARTPERVEYDPKMITIAPKAGNYLKVEKL 509 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.8 bits (54), Expect = 4.1 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 304 WVESKIIDLYPYDAGTDNGVSYMSPNSETVPRERMYRITPM 344 W ++++DL+P G V+ N + + R ++RI P+ Sbjct: 1683 WPMARVVDLHPGKDGVTRVVTLKCANGKEI-RRPIHRIAPL 1722 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.135 0.444 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 795,397 Number of Sequences: 2123 Number of extensions: 32325 Number of successful extensions: 52 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 51 Number of HSP's gapped (non-prelim): 2 length of query: 744 length of database: 516,269 effective HSP length: 69 effective length of query: 675 effective length of database: 369,782 effective search space: 249602850 effective search space used: 249602850 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -