BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001090-TA|BGIBMGA001090-PA|undefined (136 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 1.7 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 2.3 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 5.2 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 1.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 78 PSANINNFTRSGWRTKDNRDKSRS 101 P NI N ++SG KD D + S Sbjct: 360 PLNNIQNLSQSGINYKDTNDNNVS 383 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.8 bits (44), Expect = 2.3 Identities = 16/80 (20%), Positives = 29/80 (36%) Query: 18 RMKGPGGKGHAEMAVSRPRGAGVDTPTSEPGLAATDMWDSDWDEDPEELFVYRHQRRLSD 77 R K P G + + + + ++ +E D +W D E V + L++ Sbjct: 79 RSKRPNGDTNGDTSQVDDQNESLEASVNENSKNGDDDEGHEWQADVSEEAVRARMQDLTE 138 Query: 78 PSANINNFTRSGWRTKDNRD 97 + N+ R KD D Sbjct: 139 GAKNMTINDDLEKREKDRMD 158 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.6 bits (41), Expect = 5.2 Identities = 12/49 (24%), Positives = 19/49 (38%) Query: 56 DSDWDEDPEELFVYRHQRRLSDPSANINNFTRSGWRTKDNRDKSRSENE 104 DSD DE+ F R + S P + + + +N K +E Sbjct: 40 DSDNDEEERPSFKSRKPKNYSAPIGFVAGGVQQAGKKPENVKKEDESDE 88 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.132 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,497 Number of Sequences: 317 Number of extensions: 1245 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 136 length of database: 114,650 effective HSP length: 51 effective length of query: 85 effective length of database: 98,483 effective search space: 8371055 effective search space used: 8371055 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.6 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -