BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001089-TA|BGIBMGA001089-PA|undefined (54 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13438| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-24) 26 4.9 SB_10730| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-24) 26 4.9 >SB_13438| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-24) Length = 672 Score = 25.8 bits (54), Expect = 4.9 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 12 RDGEMVCVELVARGRGGSAQAVIFLGSIRYDTLTRVYDSRRG 53 R+ + V +E + RGRGG VI L IR + +T + + G Sbjct: 331 RETQRVRLETI-RGRGGRDNEVIVLSVIRREGVTLLREKNSG 371 >SB_10730| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-24) Length = 654 Score = 25.8 bits (54), Expect = 4.9 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 12 RDGEMVCVELVARGRGGSAQAVIFLGSIRYDTLTRVYDSRRG 53 R+ + V +E + RGRGG VI L IR + +T + + G Sbjct: 316 RETQRVRLETI-RGRGGRDNEVIVLSVIRREGVTLLREKNSG 356 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.330 0.144 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,590,715 Number of Sequences: 59808 Number of extensions: 40120 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 74 Number of HSP's gapped (non-prelim): 2 length of query: 54 length of database: 16,821,457 effective HSP length: 34 effective length of query: 20 effective length of database: 14,787,985 effective search space: 295759700 effective search space used: 295759700 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -