SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001089-TA|BGIBMGA001089-PA|undefined
         (54 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U39677-1|AAC47961.2|  457|Caenorhabditis elegans Hypothetical pr...    68   7e-13

>U39677-1|AAC47961.2|  457|Caenorhabditis elegans Hypothetical
           protein C16E9.2a protein.
          Length = 457

 Score = 68.1 bits (159), Expect = 7e-13
 Identities = 29/50 (58%), Positives = 41/50 (82%)

Query: 2   YRQVFCDIVVRDGEMVCVELVARGRGGSAQAVIFLGSIRYDTLTRVYDSR 51
           + +VF D++VRDGE VCVELVAR R  + ++V+FLGSIRY+ L +VYD++
Sbjct: 214 FEEVFNDVIVRDGECVCVELVARDRQKTRESVVFLGSIRYEILKQVYDTK 263


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.330    0.144    0.429 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,135,088
Number of Sequences: 27539
Number of extensions: 27352
Number of successful extensions: 60
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 59
Number of HSP's gapped (non-prelim): 1
length of query: 54
length of database: 12,573,161
effective HSP length: 35
effective length of query: 19
effective length of database: 11,609,296
effective search space: 220576624
effective search space used: 220576624
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.9 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -