BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001089-TA|BGIBMGA001089-PA|undefined (54 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39677-1|AAC47961.2| 457|Caenorhabditis elegans Hypothetical pr... 68 7e-13 >U39677-1|AAC47961.2| 457|Caenorhabditis elegans Hypothetical protein C16E9.2a protein. Length = 457 Score = 68.1 bits (159), Expect = 7e-13 Identities = 29/50 (58%), Positives = 41/50 (82%) Query: 2 YRQVFCDIVVRDGEMVCVELVARGRGGSAQAVIFLGSIRYDTLTRVYDSR 51 + +VF D++VRDGE VCVELVAR R + ++V+FLGSIRY+ L +VYD++ Sbjct: 214 FEEVFNDVIVRDGECVCVELVARDRQKTRESVVFLGSIRYEILKQVYDTK 263 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.330 0.144 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,135,088 Number of Sequences: 27539 Number of extensions: 27352 Number of successful extensions: 60 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 59 Number of HSP's gapped (non-prelim): 1 length of query: 54 length of database: 12,573,161 effective HSP length: 35 effective length of query: 19 effective length of database: 11,609,296 effective search space: 220576624 effective search space used: 220576624 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -