BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001089-TA|BGIBMGA001089-PA|undefined (54 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11680.1 68418.m01365 expressed protein predicted proteins, A... 26 2.6 At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) fa... 25 6.1 >At5g11680.1 68418.m01365 expressed protein predicted proteins, Arabidopsis thaliana Length = 207 Score = 26.2 bits (55), Expect = 2.6 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 9 IVVRDGEMVCVELVARGRGG--SAQAVIFLGSIR 40 ++VRDG V+ + G GG A+ VI+L +IR Sbjct: 22 VLVRDGVEFEVDKIPGGHGGHVKAKGVIYLSNIR 55 >At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 240 Score = 25.0 bits (52), Expect = 6.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 7 CDIVVRDGEMVCVELVARGRGGSAQA 32 C + ++D E V +EL + RGG A+A Sbjct: 74 CRVCLQDKEEVLIELGCQCRGGLAKA 99 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.330 0.144 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,108,316 Number of Sequences: 28952 Number of extensions: 27391 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 50 Number of HSP's gapped (non-prelim): 2 length of query: 54 length of database: 12,070,560 effective HSP length: 35 effective length of query: 19 effective length of database: 11,057,240 effective search space: 210087560 effective search space used: 210087560 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -