BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001088-TA|BGIBMGA001088-PA|undefined (106 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR456402-1|CAG30288.1| 404|Homo sapiens bK268H5.1 protein. 50 1e-06 BC053595-1|AAH53595.1| 370|Homo sapiens C22orf9 protein protein. 50 1e-06 BC038414-1|AAH38414.1| 475|Homo sapiens C22orf9 protein protein. 50 1e-06 AL008718-3|CAI17946.1| 404|Homo sapiens protein ( Human DNA seq... 50 1e-06 AK124648-1|BAC85917.1| 409|Homo sapiens protein ( Homo sapiens ... 50 1e-06 AB023147-1|BAA76774.1| 348|Homo sapiens KIAA0930 protein protein. 50 1e-06 BC012070-1|AAH12070.1| 539|Homo sapiens ZBTB7B protein protein. 29 3.5 AL451085-29|CAI13266.1| 539|Homo sapiens zinc finger and BTB do... 29 3.5 AB076400-1|BAB86868.1| 1097|Homo sapiens fat3 protein. 28 4.7 X83957-1|CAA58788.1| 6669|Homo sapiens nebulin protein. 28 6.2 U35637-1|AAB02622.1| 3007|Homo sapiens nebulin protein. 28 6.2 BC093405-1|AAH93405.1| 550|Homo sapiens PHF20 protein protein. 28 6.2 BC080598-1|AAH80598.1| 550|Homo sapiens PHF20 protein protein. 28 6.2 BC048210-1|AAH48210.1| 549|Homo sapiens PHF20 protein protein. 28 6.2 AY134747-1|AAN08621.1| 550|Homo sapiens medulloblastoma antigen... 28 6.2 AY027523-1|AAK13046.1| 1012|Homo sapiens transcription factor TZ... 28 6.2 AL109965-3|CAI19247.1| 1012|Homo sapiens PHD finger protein 20 p... 28 6.2 AL109965-2|CAM27594.1| 549|Homo sapiens PHD finger protein 20 p... 28 6.2 AL109965-1|CAI19246.1| 543|Homo sapiens PHD finger protein 20 p... 28 6.2 AL078461-3|CAI43145.1| 1012|Homo sapiens PHD finger protein 20 p... 28 6.2 AL078461-2|CAI43146.2| 549|Homo sapiens PHD finger protein 20 p... 28 6.2 AL078461-1|CAI43144.1| 543|Homo sapiens PHD finger protein 20 p... 28 6.2 AF348207-1|AAK19748.1| 639|Homo sapiens C2H2 zinc finger protei... 28 6.2 AF258787-1|AAG49888.1| 543|Homo sapiens glioma-expressed antige... 28 6.2 AF220416-1|AAF34184.1| 260|Homo sapiens hepatocellular carcinom... 28 6.2 AC009497-1|AAY14651.1| 2802|Homo sapiens unknown protein. 28 6.2 BC067271-1|AAH67271.1| 715|Homo sapiens zinc finger protein 544... 27 8.2 AL590225-1|CAM17813.1| 1108|Homo sapiens chromosome 6 open readi... 27 8.2 AL589910-2|CAM22452.1| 214|Homo sapiens chromosome 6 open readi... 27 8.2 AL589910-1|CAI16051.2| 1108|Homo sapiens chromosome 6 open readi... 27 8.2 AL365508-1|CAM16339.1| 1108|Homo sapiens chromosome 6 open readi... 27 8.2 AL139098-2|CAM28210.1| 214|Homo sapiens chromosome 6 open readi... 27 8.2 AL139098-1|CAI20000.2| 1108|Homo sapiens chromosome 6 open readi... 27 8.2 AL035593-1|CAM28224.1| 1108|Homo sapiens chromosome 6 open readi... 27 8.2 AF020591-1|AAC01956.1| 715|Homo sapiens zinc finger protein pro... 27 8.2 AF007833-1|AAC51847.1| 539|Homo sapiens kruppel-related zinc fi... 27 8.2 >CR456402-1|CAG30288.1| 404|Homo sapiens bK268H5.1 protein. Length = 404 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/35 (54%), Positives = 30/35 (85%) Query: 18 QVYASPSRRKMDTKGEGEEMTYPHICFMVDNFDEI 52 QV+ASPS+ MD+KGE +++YP+I FM+D+F+E+ Sbjct: 139 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEV 173 >BC053595-1|AAH53595.1| 370|Homo sapiens C22orf9 protein protein. Length = 370 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/35 (54%), Positives = 30/35 (85%) Query: 18 QVYASPSRRKMDTKGEGEEMTYPHICFMVDNFDEI 52 QV+ASPS+ MD+KGE +++YP+I FM+D+F+E+ Sbjct: 105 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEV 139 >BC038414-1|AAH38414.1| 475|Homo sapiens C22orf9 protein protein. Length = 475 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/35 (54%), Positives = 30/35 (85%) Query: 18 QVYASPSRRKMDTKGEGEEMTYPHICFMVDNFDEI 52 QV+ASPS+ MD+KGE +++YP+I FM+D+F+E+ Sbjct: 210 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEV 244 >AL008718-3|CAI17946.1| 404|Homo sapiens protein ( Human DNA sequence from clone CTA-268H5 on chromosome 22q13.2-13.3. ). Length = 404 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/35 (54%), Positives = 30/35 (85%) Query: 18 QVYASPSRRKMDTKGEGEEMTYPHICFMVDNFDEI 52 QV+ASPS+ MD+KGE +++YP+I FM+D+F+E+ Sbjct: 139 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEV 173 >AK124648-1|BAC85917.1| 409|Homo sapiens protein ( Homo sapiens cDNA FLJ42657 fis, clone BRALZ2011796. ). Length = 409 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/35 (54%), Positives = 30/35 (85%) Query: 18 QVYASPSRRKMDTKGEGEEMTYPHICFMVDNFDEI 52 QV+ASPS+ MD+KGE +++YP+I FM+D+F+E+ Sbjct: 144 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEV 178 >AB023147-1|BAA76774.1| 348|Homo sapiens KIAA0930 protein protein. Length = 348 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/35 (54%), Positives = 30/35 (85%) Query: 18 QVYASPSRRKMDTKGEGEEMTYPHICFMVDNFDEI 52 QV+ASPS+ MD+KGE +++YP+I FM+D+F+E+ Sbjct: 83 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEV 117 >BC012070-1|AAH12070.1| 539|Homo sapiens ZBTB7B protein protein. Length = 539 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 2/32 (6%) Query: 70 DVQN-LHIHRFKKTIKEHLCNKAYYKVNDHLE 100 D++N +H+H + + HLC+KA+ K DHL+ Sbjct: 416 DLKNHMHLHTGDRPYECHLCHKAFAK-EDHLQ 446 >AL451085-29|CAI13266.1| 539|Homo sapiens zinc finger and BTB domain containing 7B protein. Length = 539 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 2/32 (6%) Query: 70 DVQN-LHIHRFKKTIKEHLCNKAYYKVNDHLE 100 D++N +H+H + + HLC+KA+ K DHL+ Sbjct: 416 DLKNHMHLHTGDRPYECHLCHKAFAK-EDHLQ 446 >AB076400-1|BAB86868.1| 1097|Homo sapiens fat3 protein. Length = 1097 Score = 28.3 bits (60), Expect = 4.7 Identities = 9/26 (34%), Positives = 18/26 (69%) Query: 59 LSVRLYNKIPQDVQNLHIHRFKKTIK 84 +++R N P+D LH+H F++T++ Sbjct: 157 VTIRFENVSPEDFVGLHMHGFRRTLR 182 >X83957-1|CAA58788.1| 6669|Homo sapiens nebulin protein. Length = 6669 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 64 YNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDHL 99 Y P+DV +H+ R E L + Y+K+ D + Sbjct: 4997 YTLGPKDVPFVHVRRVNNVTSERLYRELYHKLKDKI 5032 >U35637-1|AAB02622.1| 3007|Homo sapiens nebulin protein. Length = 3007 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 64 YNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDHL 99 Y P+DV +H+ R E L + Y+K+ D + Sbjct: 1428 YTLGPKDVPFVHVRRVNNVTSERLYRELYHKLKDKI 1463 >BC093405-1|AAH93405.1| 550|Homo sapiens PHF20 protein protein. Length = 550 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >BC080598-1|AAH80598.1| 550|Homo sapiens PHF20 protein protein. Length = 550 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >BC048210-1|AAH48210.1| 549|Homo sapiens PHF20 protein protein. Length = 549 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AY134747-1|AAN08621.1| 550|Homo sapiens medulloblastoma antigen MU-MB-50.72 protein. Length = 550 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AY027523-1|AAK13046.1| 1012|Homo sapiens transcription factor TZP protein. Length = 1012 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AL109965-3|CAI19247.1| 1012|Homo sapiens PHD finger protein 20 protein. Length = 1012 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AL109965-2|CAM27594.1| 549|Homo sapiens PHD finger protein 20 protein. Length = 549 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AL109965-1|CAI19246.1| 543|Homo sapiens PHD finger protein 20 protein. Length = 543 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AL078461-3|CAI43145.1| 1012|Homo sapiens PHD finger protein 20 protein. Length = 1012 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AL078461-2|CAI43146.2| 549|Homo sapiens PHD finger protein 20 protein. Length = 549 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AL078461-1|CAI43144.1| 543|Homo sapiens PHD finger protein 20 protein. Length = 543 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AF348207-1|AAK19748.1| 639|Homo sapiens C2H2 zinc finger protein protein. Length = 639 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AF258787-1|AAG49888.1| 543|Homo sapiens glioma-expressed antigen 2 protein. Length = 543 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AF220416-1|AAF34184.1| 260|Homo sapiens hepatocellular carcinoma-associated antigen 58 protein. Length = 260 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 54 NSFGCLSVRLYNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDH 98 N G +V+ Y+ + Q V+++H+ F K +++ A K DH Sbjct: 111 NKDGTYTVKFYDGVVQTVKHIHVKAFSK--DQNIVGNARPKETDH 153 >AC009497-1|AAY14651.1| 2802|Homo sapiens unknown protein. Length = 2802 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 64 YNKIPQDVQNLHIHRFKKTIKEHLCNKAYYKVNDHL 99 Y P+DV +H+ R E L + Y+K+ D + Sbjct: 1130 YTLGPKDVPFVHVRRVNNVTSERLYRELYHKLKDKI 1165 >BC067271-1|AAH67271.1| 715|Homo sapiens zinc finger protein 544 protein. Length = 715 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Query: 62 RLYNKIPQDVQNLHIHRFKKTIKEHLCNKAY 92 + +N+ Q +++L IH +K K + CNKA+ Sbjct: 611 KAFNRSTQLIRHLQIHTGEKPYKCNQCNKAF 641 >AL590225-1|CAM17813.1| 1108|Homo sapiens chromosome 6 open reading frame 170 protein. Length = 1108 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 72 QNLHIHRFKKTIKEHLCNKAYYKVNDHLEDCT 103 +N H + F K +++H+ N + + +E CT Sbjct: 48 ENFHNYEFVKYLRQHIGNTLGSMIEEEMEKCT 79 >AL589910-2|CAM22452.1| 214|Homo sapiens chromosome 6 open reading frame 170 protein. Length = 214 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 72 QNLHIHRFKKTIKEHLCNKAYYKVNDHLEDCT 103 +N H + F K +++H+ N + + +E CT Sbjct: 48 ENFHNYEFVKYLRQHIGNTLGSMIEEEMEKCT 79 >AL589910-1|CAI16051.2| 1108|Homo sapiens chromosome 6 open reading frame 170 protein. Length = 1108 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 72 QNLHIHRFKKTIKEHLCNKAYYKVNDHLEDCT 103 +N H + F K +++H+ N + + +E CT Sbjct: 48 ENFHNYEFVKYLRQHIGNTLGSMIEEEMEKCT 79 >AL365508-1|CAM16339.1| 1108|Homo sapiens chromosome 6 open reading frame 170 protein. Length = 1108 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 72 QNLHIHRFKKTIKEHLCNKAYYKVNDHLEDCT 103 +N H + F K +++H+ N + + +E CT Sbjct: 48 ENFHNYEFVKYLRQHIGNTLGSMIEEEMEKCT 79 >AL139098-2|CAM28210.1| 214|Homo sapiens chromosome 6 open reading frame 170 protein. Length = 214 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 72 QNLHIHRFKKTIKEHLCNKAYYKVNDHLEDCT 103 +N H + F K +++H+ N + + +E CT Sbjct: 48 ENFHNYEFVKYLRQHIGNTLGSMIEEEMEKCT 79 >AL139098-1|CAI20000.2| 1108|Homo sapiens chromosome 6 open reading frame 170 protein. Length = 1108 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 72 QNLHIHRFKKTIKEHLCNKAYYKVNDHLEDCT 103 +N H + F K +++H+ N + + +E CT Sbjct: 48 ENFHNYEFVKYLRQHIGNTLGSMIEEEMEKCT 79 >AL035593-1|CAM28224.1| 1108|Homo sapiens chromosome 6 open reading frame 170 protein. Length = 1108 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 72 QNLHIHRFKKTIKEHLCNKAYYKVNDHLEDCT 103 +N H + F K +++H+ N + + +E CT Sbjct: 48 ENFHNYEFVKYLRQHIGNTLGSMIEEEMEKCT 79 >AF020591-1|AAC01956.1| 715|Homo sapiens zinc finger protein protein. Length = 715 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Query: 62 RLYNKIPQDVQNLHIHRFKKTIKEHLCNKAY 92 + +N+ Q +++L IH +K K + CNKA+ Sbjct: 611 KAFNRSTQLIRHLQIHTGEKPYKCNQCNKAF 641 >AF007833-1|AAC51847.1| 539|Homo sapiens kruppel-related zinc finger protein hcKrox protein. Length = 539 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 2/32 (6%) Query: 70 DVQN-LHIHRFKKTIKEHLCNKAYYKVNDHLE 100 D++N +H+H + + HLC++A+ K DHL+ Sbjct: 416 DLKNHMHLHTGDRPYECHLCHRAFAK-EDHLQ 446 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.322 0.135 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,272,328 Number of Sequences: 224733 Number of extensions: 530578 Number of successful extensions: 1153 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 17 Number of HSP's that attempted gapping in prelim test: 1134 Number of HSP's gapped (non-prelim): 36 length of query: 106 length of database: 73,234,838 effective HSP length: 79 effective length of query: 27 effective length of database: 55,480,931 effective search space: 1497985137 effective search space used: 1497985137 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -