BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001087-TA|BGIBMGA001087-PA|undefined (79 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0911 - 21499196-21499236,21499368-21499488,21499665-214997... 29 0.36 10_08_0910 - 21495633-21495923,21496155-21496430,21496754-214969... 29 0.36 02_05_0973 + 33209385-33209456,33210517-33210721,33210810-332109... 29 0.36 12_01_1069 - 11060045-11060262,11060404-11060545,11060624-110607... 28 1.1 08_02_0028 - 11371547-11371657,11372326-11372518,11372738-113728... 27 1.9 10_02_0078 - 4992019-4992594,4993156-4993248,4995984-4996202,499... 26 3.3 01_06_1199 + 35355690-35355732,35355793-35355930,35356366-353563... 26 3.3 06_03_0734 - 23980576-23980671,23980799-23981338,23981493-239817... 25 5.8 06_03_0832 + 25190755-25190960,25191869-25191997,25192079-251923... 25 7.7 05_05_0179 + 23022985-23023190,23024099-23024227,23024309-230245... 25 7.7 03_02_0226 - 6569657-6570388,6570461-6570748,6570846-6571303,657... 25 7.7 >10_08_0911 - 21499196-21499236,21499368-21499488,21499665-21499789, 21500187-21500418,21500488-21500668,21501342-21501438, 21501641-21501779,21502024-21502351,21502890-21503137, 21503270-21503543,21504200-21504291,21504451-21504521, 21505091-21505181,21506526-21507380,21507482-21507594, 21508007-21508074,21508655-21508835,21509084-21509186, 21509273-21509379,21510046-21511584,21511661-21511771, 21511856-21511908,21511988-21512063,21512147-21512366, 21512477-21512901,21513193-21513372,21513503-21515474 Length = 2680 Score = 29.5 bits (63), Expect = 0.36 Identities = 13/43 (30%), Positives = 23/43 (53%) Query: 23 FVRHFLFQEEQAIDCDDLLFFVRKRHVKGSSRYLPKYEVSYQD 65 F HF+F +EQ +D DLLF + ++ + P +++D Sbjct: 2219 FGHHFVFSKEQKLDWVDLLFLTTRPVEDRTTEFWPTKPPTFRD 2261 >10_08_0910 - 21495633-21495923,21496155-21496430,21496754-21496999, 21497187-21497296,21498228-21498387 Length = 360 Score = 29.5 bits (63), Expect = 0.36 Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 23 FVRHFLFQEEQAIDCDDLLFFVRKRHVKGSSRYL 56 F HF F +EQ +D DLLF V + + S+ +L Sbjct: 131 FGHHFFFPKEQKLDWADLLFLVTRPVEERSNGFL 164 >02_05_0973 + 33209385-33209456,33210517-33210721,33210810-33210975, 33211268-33211490,33211928-33212004,33212090-33212183, 33212202-33212271,33212350-33212447,33212565-33212692, 33212772-33212900,33213013-33213421,33213984-33214105, 33214224-33214313,33215092-33215304,33215453-33215584, 33216258-33216333,33216403-33216420 Length = 773 Score = 29.5 bits (63), Expect = 0.36 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Query: 5 FADSGFVVLQGTTYWTDLFVRHFLFQEEQAIDCDDLLFFV---RKRHVKGSSRYLPK 58 F G G+T WT V F Q++ +I D++F + R RH G +RYL + Sbjct: 197 FLTQGIRNFLGSTLWTVALVYGFFKQDKISISGKDIMFTLIARRSRHFAG-TRYLKR 252 >12_01_1069 - 11060045-11060262,11060404-11060545,11060624-11060776, 11060942-11061013,11062774-11063082,11063323-11063378, 11066436-11066533,11066616-11066700,11066800-11067001, 11067471-11067542,11069555-11069624,11071829-11072038, 11072337-11072609,11073912-11074183,11075354-11075557 Length = 811 Score = 27.9 bits (59), Expect = 1.1 Identities = 16/45 (35%), Positives = 21/45 (46%) Query: 23 FVRHFLFQEEQAIDCDDLLFFVRKRHVKGSSRYLPKYEVSYQDHR 67 FVRH +EE D + VR H++ S K SY D+R Sbjct: 403 FVRHEADEEESDTSDDIVPVVVRPGHIRFESAGKKKINQSYPDYR 447 >08_02_0028 - 11371547-11371657,11372326-11372518,11372738-11372814, 11373498-11373608,11374533-11374659,11374745-11375022 Length = 298 Score = 27.1 bits (57), Expect = 1.9 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 47 RHVKGSS-RYLPKYEVSYQDHRRLRRSFWH 75 + V+GSS R PK+ V ++D RS+WH Sbjct: 36 KRVRGSSERSAPKFGVLFEDVLEECRSWWH 65 >10_02_0078 - 4992019-4992594,4993156-4993248,4995984-4996202, 4996282-4996345,4996429-4996485,4996573-4996671, 4997296-4997327 Length = 379 Score = 26.2 bits (55), Expect = 3.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Query: 14 QGTTYWTDLFVRHFLFQEEQAIDCDDLLFFVR 45 +GT+Y + F R ++ Q E IDC L VR Sbjct: 84 KGTSYVYETFFRPYISQYENDIDCSILDLRVR 115 >01_06_1199 + 35355690-35355732,35355793-35355930,35356366-35356389, 35356450-35356587,35356974-35357056,35358881-35358922, 35359151-35359231,35359319-35359414,35359530-35359736, 35359810-35359963,35360170-35360373,35361037-35361921, 35362025-35362071 Length = 713 Score = 26.2 bits (55), Expect = 3.3 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 24 VRHFLFQEEQAIDCDDLLFFVRKRHVKGSSRYLPKYEVSYQDHRRLRRSFWHIEK 78 VR + +E + D L F R++ K + + YE+ ++R++R FW E+ Sbjct: 354 VRTSINRETSSNDMMQALEFFRRQQEKDPNFF---YEIDLDENRKVRNLFWTDEQ 405 >06_03_0734 - 23980576-23980671,23980799-23981338,23981493-23981714, 23981791-23982144,23982460-23982546 Length = 432 Score = 25.4 bits (53), Expect = 5.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 46 KRHVKGSSRYLPKYEVSYQDHRRLRRS 72 K ++G R LP+ +V+ DHR RS Sbjct: 373 KSRLRGGGRSLPRRKVASSDHRLHARS 399 >06_03_0832 + 25190755-25190960,25191869-25191997,25192079-25192301, 25192447-25192702,25193228-25193685,25193783-25194070, 25194143-25194874 Length = 763 Score = 25.0 bits (52), Expect = 7.7 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Query: 19 WTDLFVRHFLFQEEQAIDCDDLLFFVRKRHVKGSSR---YLPKYEVSYQD 65 W + R F F + + V K++VK SS + +YE Y D Sbjct: 361 WAPAYFREFFFARMSTTQRSESMNHVLKKYVKPSSSLHGFAKRYENFYND 410 >05_05_0179 + 23022985-23023190,23024099-23024227,23024309-23024531, 23024674-23024929,23025455-23025912,23026009-23026296, 23026369-23027100 Length = 763 Score = 25.0 bits (52), Expect = 7.7 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Query: 19 WTDLFVRHFLFQEEQAIDCDDLLFFVRKRHVKGSSR---YLPKYEVSYQD 65 W + R F F + + V K++VK SS + +YE Y D Sbjct: 361 WAPAYFREFFFARMSTTQRSESMNHVLKKYVKPSSSLHGFAKRYENFYND 410 >03_02_0226 - 6569657-6570388,6570461-6570748,6570846-6571303, 6571694-6571828,6571829-6572084,6572229-6572451, 6572533-6572661,6573570-6573775 Length = 808 Score = 25.0 bits (52), Expect = 7.7 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Query: 19 WTDLFVRHFLFQEEQAIDCDDLLFFVRKRHVKGSSR---YLPKYEVSYQD 65 W + R F F + + V K++VK SS + +YE Y D Sbjct: 406 WAPAYFREFFFARMSTTQRSESMNHVLKKYVKPSSSLHGFAKRYENFYND 455 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.331 0.142 0.456 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,233,088 Number of Sequences: 37544 Number of extensions: 75867 Number of successful extensions: 151 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 145 Number of HSP's gapped (non-prelim): 11 length of query: 79 length of database: 14,793,348 effective HSP length: 58 effective length of query: 21 effective length of database: 12,615,796 effective search space: 264931716 effective search space used: 264931716 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -