BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001087-TA|BGIBMGA001087-PA|undefined (79 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR456402-1|CAG30288.1| 404|Homo sapiens bK268H5.1 protein. 27 9.1 BC038414-1|AAH38414.1| 475|Homo sapiens C22orf9 protein protein. 27 9.1 AL008718-3|CAI17946.1| 404|Homo sapiens protein ( Human DNA seq... 27 9.1 AK124648-1|BAC85917.1| 409|Homo sapiens protein ( Homo sapiens ... 27 9.1 >CR456402-1|CAG30288.1| 404|Homo sapiens bK268H5.1 protein. Length = 404 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Query: 18 YWTDLFVRHFLFQEEQAIDCDDLLFFVRKR 47 +WT +F +F+ E+ A DD+LF+VR++ Sbjct: 31 FWTWMFSTYFM--EKWAPRQDDMLFYVRRK 58 >BC038414-1|AAH38414.1| 475|Homo sapiens C22orf9 protein protein. Length = 475 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Query: 18 YWTDLFVRHFLFQEEQAIDCDDLLFFVRKR 47 +WT +F +F+ E+ A DD+LF+VR++ Sbjct: 102 FWTWMFSTYFM--EKWAPRQDDMLFYVRRK 129 >AL008718-3|CAI17946.1| 404|Homo sapiens protein ( Human DNA sequence from clone CTA-268H5 on chromosome 22q13.2-13.3. ). Length = 404 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Query: 18 YWTDLFVRHFLFQEEQAIDCDDLLFFVRKR 47 +WT +F +F+ E+ A DD+LF+VR++ Sbjct: 31 FWTWMFSTYFM--EKWAPRQDDMLFYVRRK 58 >AK124648-1|BAC85917.1| 409|Homo sapiens protein ( Homo sapiens cDNA FLJ42657 fis, clone BRALZ2011796. ). Length = 409 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Query: 18 YWTDLFVRHFLFQEEQAIDCDDLLFFVRKR 47 +WT +F +F+ E+ A DD+LF+VR++ Sbjct: 36 FWTWMFSTYFM--EKWAPRQDDMLFYVRRK 63 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.331 0.142 0.456 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,211,883 Number of Sequences: 224733 Number of extensions: 351986 Number of successful extensions: 4010 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 4010 Number of HSP's gapped (non-prelim): 4 length of query: 79 length of database: 73,234,838 effective HSP length: 58 effective length of query: 21 effective length of database: 60,200,324 effective search space: 1264206804 effective search space used: 1264206804 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -