BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001084-TA|BGIBMGA001084-PA|IPR003701|DNA repair exonuclease, IPR004843|Metallophosphoesterase, IPR007281|Mre11, DNA-binding (628 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 25 1.6 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 23 4.8 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 23 4.8 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 23 4.8 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 23 6.3 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 81 IRKYCLGDKPVSIELLSDQIKNFSRTVNYED 111 IRKY LG+K +S + D + FS + D Sbjct: 370 IRKYYLGEKKLSKKTFRDLVAMFSDRIFIND 400 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 4.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 81 IRKYCLGDKPVSIELLSDQIKNFSRTVNYED 111 IRKY LG+K +S + + + FS + D Sbjct: 370 IRKYYLGEKKLSKKTFRELVAMFSDRIFIND 400 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 4.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 81 IRKYCLGDKPVSIELLSDQIKNFSRTVNYED 111 IRKY LG+K +S + + + FS + D Sbjct: 370 IRKYYLGEKKLSKKTFRELVAMFSDRIFIND 400 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 4.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 81 IRKYCLGDKPVSIELLSDQIKNFSRTVNYED 111 IRKY LG+K +S + + + FS + D Sbjct: 370 IRKYYLGEKKLSKKTFRELVTMFSDRIFIND 400 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 81 IRKYCLGDKPVSIELLSDQIKNFSRTVNYED 111 IRKY LG+K +S + + FS + D Sbjct: 370 IRKYYLGEKKLSKRTFRELVAMFSDRIFIND 400 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,911 Number of Sequences: 317 Number of extensions: 5346 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 628 length of database: 114,650 effective HSP length: 61 effective length of query: 567 effective length of database: 95,313 effective search space: 54042471 effective search space used: 54042471 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -